The URL can be used to link to this page

Home My WebLink About324 20TH ST - Building Permits(714) 754-5273 • Fax (714) 754-4856 • wv+w.ci.costa-mesa.ca.us 77 FAIR DRIVE, COSTA MESA, GA 92626 BUILDING PERMIT .lob Address: 324 E 20TH ST Suite: Vicinity: APT BLDG Parcel Number: 42622140 Applicant: WHITNEY, ROBERT Address: P015396 NEWPORTBEACH,CA Owner: NIEUPORT INVESTMENTS Address %LANCOINVESTMENTS THOUSAND OAKS,CA 1394 E HILLCREST DR Contractor: WHITNEY ROOFING Address: P015396 NEWPORTBEACH,CA Zip: 92659 Arch : Address: Zoning: Phone: (949) 548-0769 Zip: 92659 Phone: Zip: 91362 Phone: (949)548-0769 License: 406022 Eng: Address: Status: ISSUED Applied: 03I05/2004 Issued: 03/OS/2004 ISSUED 8Y: Phone: Phone: Zip: License: License: SCOPE OF PERMIT REROOF APT BLDG ONLY: T/O EXISTING B.U.R. ROCK ROOF AND REROOF WITH SAME. 65 SF Plan Check: $0.00 Permit: $195.25 SMIP Res: $1.10 SMIP Com: $0.00 Other: $0.00 Inspection: $0.00 Total: $196.35 SETBACKS MAIN STRUCTURE Front 0- 0 ACCESSORY Front 0- 0 PARKING Existinq: o NOTES: Rear 0- 0 Rear 0- 0 Required: 0 FEE SUMMARY PLANNING 8 ZONING LeR 0- 0 Left 0- 0 Proposed: 0 Calc Valuation: Claim Valuation: Right 0- 0 Right 0- 0 s>>,000.00 s>>,000.00 NOTICE: The work authorized by this permit shall comply with all applicable handicap access requiremenis under California statutes and related regulations. (Ord. No. 92-28, § 1, 12-21-92) EXPIRATION: This permit shall automatically expire and become void if work is not commenced within 1 BO days, or if work Is suspended or abandoned for a period of 180 days. INSPECTIONS: In order tor ihe work authorizetl under ihis permit to be considered legal, such work must comply with all applicable codes, and all requlred Inapectlons and final approval must be obtained. Failure to obtain inspections and final approval will result in the expiration of this permit. FOR INSPECTIONS CALL: (714) �545626 2446d8 (B/00) WORKEpS' COMPENSATION DECLARATION: . I hereby aNirm untler panalry of perjury one of ihe following declarations: ❑ I have and will maintain a certificate of consent to self-Insure tor workers' compensation, as �work for which ihis permit is issuetl. I have antl will maintain workers' compensation insurance,�s required jf section 3700 o e My workers' compensation Insurance ca�er and policy4fu1h6er ars! / Carrier. (This section need not be complete ❑ I certify [ha� in the pertorman� compensation laws of Califori comply with these provisions. Applicant SignaNre: WARNING: FAILURE TO SECURE WORI THOUSAND DOLL4RE ($100,000), IN ADI LICENSED CONTRACTORS DE I hareby aHirm that I am licensed force and ettect. Lia N Contractors Signature: ane of ihe COMPENSATION COVERAGE IS by section 3700 of ihe Lebor Code, for ihe pertortnance of Ihe Labor Cotla, Por the peAortnance ot Ihe work for whiccrh�this permit is issued. PolicyNumber. �JC9[ �� / or less.) I shall not employ any person in any manner so as to to the workers' compensation provisions of Seclion f _ Date: AND SHALL SUBJECT AN EMPLOVER TO CRIMINAL =5 AS PROVIDED FOR IN SECTION 3]O60F THE LAE 9(commencing with Section 7000) ot Division 3 of iha Business . _ ... . . Class # to the workere' ' Cotle, I shall forihwith i AND CIVIL FINES UP TO ONE HUNORED INTEREST, ANO ATTORNEY'S FEES. CONSTRUCTION LENDING AGENCY: � ❑ I hereby attirm Ihat there is a consimction lending agency for the pedormance oi the work for which Ihis permit is issued. (Sec. 3097, Civil Code). Lender's Name: Lender's Address: SignaNre: Date: my license is in full OWNEfi-BUILDER DECLARATIONS: I herehy aflirm ihat under penal�y of perjury ihat I am EXEMPT FROM THE CONTRACTORS LICENSE LAW for lhe fol�owing reason (Sec. 7031.5, Business and Professions Code: Any city or county which requires a permit b constmct, alter, improve, demolish, or repair any stmcNre, prior to its issuance, also requires the applicant for such permit to file a signetl statament that he or she is licensed pursuant to ihe provisions ot ihe Contrectors License Law (Chapter 9(commencing with Section 7000) ot Division 3 of the Business antl Professions Code) or that he or she is exempt therefrom and the basis for the alleged e:emption. Any violation of Section 7031.5 by any applicant tor a parmit subjects the applicant to a civil penalry of not more than tive hundretl tlollars ($500).): ❑ I, as owner of the propetly, or my employees with waqes as their sole compensation, WILL DO THE WORK, and the strucWre is not intended or offered for sale (Sec. 7044, Business and Protessions Code: The ConGactors License Law does not apply to an owner of property who builds or improves �hareoq and who tloes such work himself or herself or through his or har own amployees, provided ihat such improvemenis are not intended or ottered tor sale. If, however, the building or improvement is sold within one year oi completioq the owner-builder will have the burden of proving that he or she did not build or improve tor puryose of sale.). • ❑ I, as owner of the property, am E%CLUSIVELY CONTRACTING WITH LICENSED CONTRACTORS to construct the project (Sec. 7044, Business antl Professions Code: Tha contractors License Law does not apply to an owner of propeny who builds or improves Ihereon, and who comracis tor such project with e contractor(s) license pursuant to the Coniractors License Laws.). ❑ I am exempt under sec. Business and Professions Code tor this reason: Signature: Date: Owner ID verifietl by tlnver's license. ❑ Ves ❑ No Drivefs License No. Expires: Veritication of Ownership by (type of document, i.e. - property taz bill or deed): DIVISION OF INDUSTRIAL SAFETY PERMIT CERTIFICATION: ❑ I hereby cetlity ihat no excavation five (5) or more feet in depth into which a person is required to descend, will be matle in connection with work authonzetl by ihis permit, and ihat no 6uilding sirudure, scalloltling, falsework, or demolition or dismantling thereot, will be more than ihitly-six (36) teet high. (Chap. 32, Grp 2, Atl 2, Sec. 341, Title e, California Administrative Code). ❑ As owner-huiltler, I will not employ anyone to do work which would require a permit irom the Division of Industrial Safety, as noted above, unless such person has e permit to do such work irom Ihe division. Signature: Division of Indusirial Safety Permit Number: Date: HAZARDOUS MATERIALS AND EMISSIONS CER7IFICATION: 1 W ill the epplicant or present or fmure builtling ocwpant need to file and certify a Business Plan tor emergency response to release or threatenetl release of a hazardous materiai? ❑ Ves ❑ No (Section 25505 of the Calitornia HeaHh and Safery Code requires, with some exceptions, that a Business Plan be filed with the Costa Mesa Fire Department by every business which has at any one time tluring a reported year a quantity ot hazardous ma�erials equal �o or 9reater than a weight of 500 pounds, or a volume of 55 gallons, or 200 cubic feet of compressed gas at standard temperawre and pressure). ....... ....... ... ......................................... ................................................................................................................................................................................................................................................ . . 2 Does or will Ihe applicant or present or tuture building occupant neetl m file a registretion torm for acutety hazardous materials. ❑ Yes ❑ No (Section 25533 of the Calitornia Health and Safery Cotle, with some exceptions, requires registration wiN the Costa Mesa Fire Departmant by each business which at any one time has on hand a quantiry ot acutely hazardous materials equal to or greater than e weight of 500 pounds, or a volume oi 55 qellons, or 200 cubic teat of compressed gas at standard tempereture and pressure). ........................................................................................................................................................................................................................................................................................................................................................................................ 3 Does or will the applicant or present or tuture building occupant need to prepare an RMPP (Risk Management and Prevention Program for acutety hazardous materials)? l ot ihe Calitornia Healih and Safery Code provitles ihat Ihe Costa Mesa Fire Department may require the preparatioq certification and filing with the Fire en RMPP by businesses which are required to register acutely hazardous materials wi�h the Fire Department. 4 If an RMPP is presently requiretl, has Section 25534 ot ihe Califomia Heelth antl Satery Gotle been fully compuetl witn't U ves LJ rvo ............................................................................................................................................................................................................................................................................................................................................................. 5 Does or will ihe applicant or preseM or fuWre building occupan� require tot Ihe work which is the subject of lhis �plica�ion agermil for such cons�ruction or irom the South Coest Air Qualiry Management District or irom any other air polWtion conVol tlisVict or agancy? LJ Yes LJ No (Section 658502 ot ihe Celifornia Govemment Code requires that ihe requested informe6on 6e furnished on applications for non-residential building permits). ..................................................................................................................................................................._................................................................._........................................................... 6 Will any part of the facility to be cronstmcted untler this permit be within 1000 feet from Ihe o er boundaries of a school? ❑ Yes ❑ No . Qf "yes,',_ ihe tacility. must.meet, ihe, requirement. of. Sections_25534.and.42303, oi, ihe, Californ' . Health.and. Safety. Code): 7 fl a permit irom the Sou�h Coest Air Quality Managemen� District or o�her av polWtion�ntrol distnct or agency is required tor Ihe work which is ihe si aoolication, have all of the disclosures prescnbed by Califomia Health and Safery Code S ction 42303 been made? ❑ Ves ❑ No Qf "yes", attach certificate of compliance irom Ihe appropriate air pollution cor CERTIFICATE OF COMPLIANCE: I certiTy Ihat under penalty of perlury ihe regarding Hazardous Materials and Emissions. Signature: given above is wrrect I agree to comply with all state laws and ciry ortlinances Date: CERTIFICA7E OF COMPLIANCE AND AU7HORIZATON OF ENTRY: I ce � under penalty ot perjury that I have read this application and state that the iMormation given is correct. I agree �o comply with ell state laws and ciry ordinances rela�i o builtling consimction, antl authorize representatives of the City of Costa Mesa to enter upon the above-descri6ed property for inspection puryoses. 1 ag�not to occ or allow occupancy oi any building authonzed by this permit unfil final inspection. COpEM, INSPECTIONTYPE 1616 Fixed System Final Fire Prevention 1266 200 201 202 203 204 Pool Spe Final Final Re-Roof Final BIocWRetaining Wall Final Factory Fire Place Final Sign Final Demolition � Q� INTRI 3 l� aY� COpEN INSPELTIONTYPE 206 Final Mechanical 208 270 212 220 Final Plumbing Final Elecirical Final Fira Prevention Final Planning Approval 222 Final Site 250 Final Building/Occupancy P97E wu. �d (714) 754-5273 • Fax (714) 754-4856 • w�w+.ci.costa-mesa.ca.us 77 FAIR DRIVE, COSTA MESA, CA 92626 BUILDING PERMIT ,lob .4ddress: 324 E 20TH ST Suite: Vicinity: APT BLDG Parcel Number: 42622140 npp�icant: WHITNEY, ROBERT Address: P015396 NEWPORTBEACH.CA Zoning: Phone: (949) 548-0769 Zip: 92659 Owner: NIEUPORT INVESTMENTS Address %LANCOINVESTMENTS THOUSAND OAKS, CA Phone: 1394 E HILLCREST DR Zip: 91362 Contractor: WHITNEY ROOFING Address: P015396 Arch : Adtlress: Phone: (949) 548-0769 NEWPORTBEACH,CA Zip: 92659 License: 406022 Phone: Eng: Address: ISSUED BY: Status: ISSUED Applied: 03/OS/2004 Issued: 03/OS/2004 Phone: Zip: License: License: SCOPE OF PERMIT REROOF APT BLDG ONLY: T/O EXISTING B.U.R. ROCK ROOF AND REROOF WITH SAME. 65 SF Plan Check: Permit: SMIP Res: SMIP Com: Other: Inspection: Total $0.00 $195.25 $1.10 50.00 �0.00 $0.00 $'196.35 SETBACKS MAIN STRUCTURE Front 0- 0 ACCESSORY Front 0- 0 PARKING Existin : 0 NOTES: Rear 0- 0 Rear 0- 0 Required: 0 FEE SUMMARY Calc Valualion: S�i,00o.00 Claim Valuation: S�i.000.00 PLANNING & ZONING Lefl 0- 0 Righl Left 0- 0 Right Proposed: 0 NOTICE: The work euthorized by ihis permit shall comply with all applicable handicap access requlrements under Callfornla statutes and related regulatlons. (Ord. No. 9248, § 1, 12-21-92) EXPIRATION: Thls permlt shall automatically expire end become void II work Is not commenced wlthin 180 days, or if work Is suspended or ebandoned for a period ol 180 days. INSPECTIONS: In order for the work euthorizetl under ihis permit to be considered legal, such work must comply with all applicable codes, and all required Inepectlons antl tinel approval must be obtained. Failure to obtain Inspecllons and tinel approval will result in the explretlon of this permlt. FOR INSPECTIONS CALL: (714) 759-5626 saa�ee �emo� WORKERS' COI�PENS.ATION DECLAppnON: I hereGy eflirm untler penalty ot perjury one ot t�e tollowing tleclarations: ❑ I heve entl wlll meintain e cenilicatg of conseni to self�lnsura tor workers' wmpensatlan, es providetl lor by section 3700 ot lhe Labor Code, tor Ihe pertormance oi Ihe work for which �his permit is luued. �I have end wlll meintain workers' compensatlon insuraxe, az requiretl by section 3700 of ihe Lebor Code, br the peAormance ot ihe work for which thts pertnit Ls iswetl. My workers' compensetlan Insuren� rrie/r end poli umber ere: � A� �� Carrier. f Policy Number. G (Th/s secfion neetl no( be crompletetl i/ the ermitls ve/u d et on hundretl dollers (S 100) ar less.) I cenly thet In the peAormance of ihe work 1 ich thi ermit is issued, I shell not employ any parson In eny manner so as to b�y ome ubject to tha workers' � compensatlon lews of Calllomla, entl e at It I s Itl bernme sublact b the workors' compansntlon provlslons of Sectlon 3 00 0�6 Lebor Code, I shall forthwilh complY with ihese provisions. � / Appllcenl Signnture: Deta: -S � N WARNINO: FAILURE TO SECURE WOPKE ' OM NSnTION COVERAGE IS UNLAWFUL AND SWLLL SUBJECT AN EMPLOVER TO CRIMINAL PE ES AND GVIL FlNES UP TOONE HUNDRED THOI,l54tJD00LLARE(S1CO.00OAM'�� iOTMECQSiOFCOAIPENS4TIQN,DNMGE5A5➢ROVIDEDFORINSECTION3]OBOFTME fADE,IMEAESi,M'DATIORNEY'SFEES. LICENSED CONTRACTORS DECLARA710N: I hereby aHirm Ihat I am Ilcensed under pro ' brce entl eHect. Llc. a Gon�rectoYs Slgnawre: 9 mmencing with Sectlon 7000) ol Divislon 3 of the Business antl ��i0 Z � Class q CONSTRUCTION LENDING AGENCV: / ❑ I here6y aHirtn that Ihere Is e construction lending egenty tor t�e peAormance ol tha wark lor which Ihis pertnit is issued. (Sec. 3097, Civil Cotle). Lentlefs Neme: Lendefs Address: Signawre: Date: my license is in lull OWNER-BUILDER DECLARATIONS: � I here6y aflirtn that untler penalry at parjUry thet I em E%EMP7 FROM 7ME CONTRACTORS LICENSE lAW tor the lollowing reeson (Sec. 7037.5, Business antl Pmfessions Code: Any ciry or coumy which requires e permit to cons�ruct, alter. improve, demolish, or mpair any siructure, prior to its issuance, also requires the epplicant for such permit ro fife e stgnetl statement thaf he or she Is licensetl pursuant to the pmvisions of the Contrectors IJcense Law (Chapter 9(cnmmendng wiM Section 7000) ot DiWsian 3 ot Me Business end Profeulons Code) or that ha or sha is axempt therefrom entl the Desis tor the alleged azemption. Any violatlon of Section 7037.5 by eny epplicant tor e permit subjects Ihe epplicant to e civil penalry oi not more Ihan five huntlretl tlollers ($500).): ❑ I, es owner ot t�e pmperty, or my employees with wages as thelr sole compensatlon, WILL DO THE WORK, end the sirucwre Is not Intendetl or otteretl br sale (Sec. 7044, Business and Pmfesslons Cotle: Ttia Contractors License Law does not apply to an owner of propaay who builtls or improves thereon, and who does such work himselt or herselt or thwugh his or her own employees, provided Ihat such improvements are not Intended or oflered tor sale. If, however, the builCing or improvemenl Is soltl within one year ot complelioq the owner-builder will heve ihe Durden ol pwving that he or she did not build or improve for purpose oi saleJ. ' � I, es owner of Ihe property, em E%CLUSNELY CONTRAC7ING WITH LICENSED CONTRACTORS to construct the prolecf (Sec. 7044, 8usines5 antl ProfesSions Cotle: The contractors License Law does not apply to an owner of propeny who bullds or Improves thereon, end who contrects for such project with a contrector(s) license pursuant to Ihe Contractws Licensa Laws.). ❑ I am exempt untlar sec. Business and Professions Cotle tor this reason: Signamre: Date: Owner ID verifled by tlriver's license. ❑ Yes ❑ No Drivers Licensa No. Expires: VenNcation of Ownership by (type ol documem, i.e. - property ta�c bill or deed): DIVISION OF INDUSTRIAL SAFETY P�RMIT LERTFICATION: ❑ I hereby certify thai no excevetlm five (5) or more Ieel in depth into whic� e person Is requlred to descend, will be metle in connection with work euthodzed by this permit, arW that no building siructure, ScaMoldmg, talsework, or demolitlon or di5mantling the�eol, will �a rtrora Ihan thlrty-s!x (36) /eet high. (Chap. 3.2, Grp 2, Art 2, Sec. 341, Tule B, Calitomla AtlministreWe Cade). ❑ As owner-bulider, I will not employ enyone to da work which would require e permit irom the Divislon ol Indus�nal Sefery, as notetl above, unless such peraon hes e permit to tlo suc� work tram Ihe division. Signature: Dale: Divislon ol Intlustrial Selery Permit Number. :ARDOUS MATERIALS AND EMIS$�ONS CERTFICATON: W III lhe applicent or present or future bullding acupaN need to lile ond cehlty a Buslnass Plen tor emergency response to releese or threatenetl release af e huzertlous maleriel7 ❑ Yes ❑ No (Sectlon 25505 0l ihe Celifornle Hgelth and Sefety Cotle roqulres. with some exceptlons, Ihet e Business Plen be filed with Ihe Costa Mesa Fire Depenment by every buslness which has at eny one lima during e reported year e Quemiry ol hezertlous melerials equel lo or greater ihan a weight ot 500 pounds, or a volume oi 55 gallons, or 200 cubic leet of compressed ga9 et stendard tempereture antl pressure). ............................................................__._-..._.____..._._.._"...__._.............__._._................................_...................................................................._.................. ...._................. ........._......................_........... Does or will the apDlicant or presenl or luWre builAing occupem neetl to lile e regislration lorm br ecutely �azerdous matenals7 ❑ Ves ❑�No (Seclion 25533 ot the Calllamie He01th flnd Sefery CaAe, wit� wme exce tlons, requires repisiretlon with ihe Costa Mese Fire Departmenl by eech buslness whlch et eny one time hes on hend a quentiry 01 ecutely hezardous meterials equePto or greeter then e welght ol 500 pounds, or e volume of 55 gellons, or 200 cublc teet ol compressed ges et stantleM tempereture end pressura). ..................................................................._.........,.......................................__.................................................................................................................................................................._.........................�............_........._........._ Does or will theep plicant or Dreseni or tuWre building oauDant neetl to prepare an RMPP (Risk Management and Prevention Program for ecNely harardous metedals)? ❑ Y85 ❑ No (Section 25534 ot the Calitomia Health and Satety Coae provides that Ihe CosW Mese Fire Department may requlre �he preparation, certification flntl IiMg wlih the Pire Depariment ol en RMPP by busine55es whic� ere required to register ecutely �eeardaus matedels with �he Fire Depenment. ,__ ................._ -.--,_'_'_' _'....._—............._.....�..........................................................'_'........_ _........_"—"___ II en RMPP Is oresenilv reauired, hes Section 25534 of the Califomia Heelih and SefeN Cotle been tulty wmplied with'I ❑ Yas ❑ No Does or will Ihe applicant or presen� or tutura builtling occupem raqWre for t�e work which Is i�e sub�ect ot Ihls e plitalion e pertnii �or such trom the South Coest Air Oualiry Management District or frwn eny other air pollutlon control dlstrict or egency? � Ves CJ No (Section fi58502 of the Califomla Govemment Code requires t�at the reQuested infortnation Ee tumishetl on epplications for nomresitlential bi ..._ .........................__._..__......._._........................_..........._.................................._.................................._........................................................................................ ........................ ..... W ill eny part ol the fadliry to be construcied under this pertnit he vrithin 7000 leat trom the outer bountleries ol a school? ❑ Yes ❑ No (II yes", ihe lacility must meet Ihe rgquirement of Sections 25534 and 42303 0l iha Calitomia Heelth antl atey Cotle). .._ ................._"'_ ""'—___..._.................. ....___._........_..__........._.....—.._ If e pertnit Irom Ihe South Coest qir �ualiry Management Distnct or olher eir pollutian conirol distnc or egenry is required tor the work aoollcation, heve ell of the tlisclosures orescribed Dv Calitomia Mealth and Sefery CaOe Secilon 42303 en matle? ❑ Yes ❑ No COMPLIANCE: I certity t�at under penalry of perjury t�e infortnation given �s Metedels and Emissions. Signeture: CERIIFICATE OF COMPLIANCE AND AUiHORVA710N OF ENTHV: I certify untler correct. I egree to comply wilh ell state laws entl dty ortlinances r mg to huildl ebove�descrihed pmperty lor inspection purposes. I agree no cupy or allo� COOE I. INSPECTIONTYPE 1618 Fixetl Sysiem Final Fire Pravention 1288 Pool Spa Final 200 Final Re-Root 201 PInelBlocWRetaining Well 202 Final Fectory Fire Place 203 Final5lgn 204 Finel Demolltlon {�g �S or modiflca0on perm�u). correct. I egree to wmpty with ell state laws and dry ardinances Date: � ol perjury that I heve read this epplication and state ihat the intortnatlon given is �ctlon, end authodze representetives ot the Clly ofFosta Mesa to enter upon the of eny building euthonzed by this permit until lineljfispection. COUE 1 INSPECTION TYPE 206 Finel Mec�enical 200 Finel Plumbing 210 Finel Eleclrical 212 220 222 250 Finel Fire Prevention Final Planning Approval Final Site Final Building/Occupancy PAg It�ALB (714) 754-5273 • Fax (714) 754-4866 • www.ci.costa-mesa.ca.us 77 FAIR DRIVE, COSTA MESA, GA 92626 BUILDING PERMIT Job Address: 324 E 2pTH $T Suite: Vicinity: APT BLDG Parcel Number: 42622140 Applicant: WHITNFY, ROBERT Address: P015398 NEWPORTBEACH,CA Owner: NIEUPQRT INVESTMENTS Address %LANCOINVESTMENTS 7HOUSAND OAKS, CA 1394 E HILLCREST DR Contractor: WHITNEY ROOFING Address: P015398 Arch : Address: NEWPORTBEACH,CA Zip: 92659 Phone: Zoning: Phone: (949) 548-0769 Zip: 92659 Pbone: Zip: 97362 Phone: (949) 54&0769 License: 406022 Eng: Address: Status: ISSUED Applied: 03/OS/2004 Issued: 03/05/2004 ISSUED BY: Phone: 2ip: License: License: SCOPE OF PERMIT REROOF APT BLDG ONLY: T/O EXISTING B.U.R. ROCK ROOF AND REROOF WITH SAME. 65 SF Plan Check: Permit: SMIP Res: SMIP Com: Other: Inspection: Total $0.00 $195.25 $1.10 $0.00 $0.00 $0.00 $196.35 SETBACKS MAIN STRUCTURE Front 0- 0 ACCESSORY Fronl 0- 0 PARKING Existin : p NOTES: Rear 0- 0 Rear 0- 0 Re uired: 0 FEE SUMMARY PLANNING & ZONING Left 0- 0 Left 0- 0 Proposed: 0 Calc Valuation: Claim Valuation: Righl 0- 0 Ri9ht 0- 0 s� i,000.00 s� i,000.00 NOTICE: The work authorized by this permit shall comply with all applicable handicap access requirements under California statutes and related regulations. (Ord. No. 92-28, § 1, 1$-21-92) EXPIRATION: This permit shall automatically expire and become void if work Is not commenced within 1 BO days, or if work is suspended or abandoned for a period of 180 days. INSPEC710NS: In order for the work authorized under this permit to be considered legal, such work must comply with all applicable codes, end ell required Inspeetione and final epproval must be obtained. Failure to obtain Inspections and final approval will result in tha expiration of this permit. FOR INSPECTIONS CALL: (714) 7545826 244&d8I8100) WORKERS'COMPENSAnON DECLARAnON: - I hereby aHirm under penelry of perjury one ot the tollowing declarations: ❑ I have entl will meintain e certiticata of consent to self-Inswe for workers' c mpensatlon, es provitletl br by section 3700 of the Labor Code, for the pertormence ot ihe �work lor which this'permit Is issuetl. I have entl will mei in worker ' compensati0n insurance, as required by 5 tion 3�00 ot ihe Lebor Code, for lhe pedormance oi Ihe woM for which this pertnit Is issued. My workers' co on ur ce carner and policy number are: p Cerner: Policy Number: �Yl'.(� ii' 0� % (This section ne wt be ca p/eted i!!he Oermit is valuetl at one hundr dollars (5100) or less.) . ❑ I certity Ihe� in the pertormance of the wo ch this pe is issued, I shell not employ any person in any manner so as to 6ecome suD�ecyto the workers' compensatlon laws of Celifomia, s re � ii I shou ecame sub�ect ta t�e workers' compensetion provisions of Saction 3700 of t e La 6r Co4e, I shell torthwith comply with Ihese provisions. Applicant Signeture: � Dete: V � WAFNING: FAILURE TO SECUPE WORK S' COMP ATION COVERAGE IS UNLAWFUL AND SMALL SUBIECT AN EMPLOVEP TO CPIMINAL PENALTIE AND VIL FlNES UP TOONE MUNDqED THOUSAND OOLURE (5100,000), IN IT1PY TO TME Cp$T OF CQNPENSATION, DMNGES AS PROVIDED FOR IN SECiION 3/06 OF THE LABOfl CWE, IM EST, AND ATTORNEI"S FEES. LICENSEO CONTRACTORS DECLARATION: I hereby aHirm that I am licensed under provisions of Cha r 9(com ncing with Section 7000) of Division 3 of the Business and ProtQssi s otle, antl my license is in full force end eilect, Lic. M Class p L�''PC Contrecmr's Signetura: Dete: CONS7RUCTION LENDING AGENCV: ❑ I hereby eHirm that Ihere is a construction lending agency for the peAormance of �he work br which t�is pertnit is issued. (Se . 3097, Civil Code). Lentlers Neme: Lender's Adtlross: Signawre: Date: OWNER-BUILDER DECLARATIONS: I hereby attirm that untler penalry of perjury thet I em E%EMP7 FROM THE CONTRACTORS LICENSE LAW for the following raason (Sec. 7031.5, Business entl Professions Cotle: Any ciry or counry which requlres a pertnit to conslrucL alter, improve, demolish, or repair any structure, O�or to its issuance, also requires the epplicant tor such pertnit to file e signed atatament that he or she Is licensed pursuant to the provislons of t�e Contrectore License Lew (Chepter 9(commencing with Sectlan 7000) of Division 3 0l the Business entl Pratessions Code) or thet he or sha is ezempt therefrom end the basis lor the elleged exemption. Any violation at Sectian 7031.5 Dy eny epplicent for e pemit subjects the epplicent to e civil penelry oi not morp than live hundred dollars (5500).): ❑ I, es owner of Ihe propeny, or my employeeg with wages as thalr sole compensailon, WILL DO TME WORK, antl the structure is not intended or oHerad for sale (Sec. 7044, Business and Professions Cotle: The Contractors License law does not apD�Y �a an owner of property who builds or improves thereon, and who tloes such work himself or harself or �hrough �is or her own gmployees, provided ihat such Improvements ere not IntenOetl or oHered tor sale. If, however, Ihe building or improvement is sold within ono year of completion, the ownar-builder will have �he burden ol proving ihat he or she diA not builtl or improve tor purpose ol sele.). ' ❑ I, as Owner of �he propeM. am E7(CLUSIVE�y CONTRACTING WITH LICENSED CONTFiACTOFS to wnstruc� Ihe prolect (Sec. 7044, Busine55 end Prolessions Code: 7he contrectors License Lew does npt flpply to en owner ol pwpeny who builds or Improves theraon, and who contrects for such pro�ect with a comractor(s) license pursuant to ihe Contractors License Laws.). � I am ezempt under sec. Business end Professions Cotle tor this reason: Signewra: Date: Owner ID ventied by tlnver's license. ❑ Ves ❑ No �river's License No. Expires: Verificetion of Ownership 6y (type of tlocumem, i.b. - property tar bill or deed): DIVISION OF INDUSTRIAL SAFETY PERMIT C�qT1FICATION: ❑ I hereby certily that no excavetion five (5) or more teet in depth into which e person is required to descend, will be matle in connection with work authorized by ihis permit, and thet no building structure, scaHolding, falsework, or demolition or dismantling Ihereof, will be more than thiny-six (36) feat high. (Chap. 32, Grp 2, Ar12, Sec. 341, Tltle B, Celifomla Atlministrative Code). ❑ As ownervbuiltler, I will not employ enyone to do work which woultl require a pertnil irom the Division of Industnel Sefery, as noretl eDove, unless such person hes e permll �o do such work trom tha division. Signature: Date: Division ol Indusirial Safety Permit NumDer: CERTIFlCATE OF COMPLIANCE AND AUTHORIip710N OF V: 1 certity untler penalty ot perjury Nat I have read ihis epplication entl state ihat the information given is correct I egree to comply with all stete I s entl city ordin es releting to builtling consWClion, end euthonze representatives of the Clry ot Coste Mesa to enter upon Ihe ebove-descnbed propeny tor i io rposes, I agre ot to occupy or ailow acupancy of any builtling authorized by this per�t uftil final inspection. GO�E I, INSPECTIONTYPE 1616 Fixed System Final Fire Prevention 1266 Pool Spe Final 200 Finel Re-Roof 201 Flnal BIwWRetaining Wall 202 Final Factory Fire Place 203 Final Sign 204 Final Demoll�ion P�g It�LS CppE1 INSPELTIONTYPE // 206 Final Mechanical 208 Final Plumbing 210 Final Electriwl 212 Final Fire Prevention 220 Final Planning Approval 222 Final Site 250 Final BuildinryOccupency /, (71a) 754-5273 • Faz (�14) 754-4856 • www.ci.coste-mesa.ca.us 77 FAIR DRIVE, COSTA MESA, CA 92626 BUILDING PERMIT .lob nddress: 324 E 20TH ST Suite: Viciniry: RECREATION ROOM AT CENTER OF AN APT COMP Parcel Number: 42622140 App�icant: LANDRY, PHILIP T Add�055: %LANCOINVESTMENTS THOUSAND OAKS,CA 1394 E HILLCREST DR Zoning: Phone: 805�551-9372 Zip: 91362 Owner: NIEUPORT INVESTMENTS Address %LANCOINVESTMENTS THOUSAND OAKS, CA Phone: 1394 E HILLCREST DR 2ip: 91362 Con tractor: O W N E R-B U I LD E R Address: Zip: Arch : Address: Phone: License: 000000 Eng: Address: Phone: ISSUED BY: StaWs: ISSUED Applied: 09/17I2002 Issued: 09/17I2002 Phone: Zip: License: License: SCOPE OF PERMIT CHANGE-OUT OF TWO 4' X 5'6" WINDOWS WITH TWO FRENCH DOORS (3°X 6'8") IN AN EXISTING APT RECREATION ROOM. HEADER SIZE WILL BE THE SAME. Plan Check: $0.00 Permit: $69.25 SMIP Res: $0.50 SMIP Com: $0.00 Other: $0.00 Inspection: $0.00 Total: $69.75 SETBACKS MAIN STRUCTURE Front 0. 0 ACCESSORY Front 0. 0 PARKING Existinq: 0 NOTES: Rear 0. 0 Rear 0- 0 Reauired: 0 FEE SUMMARY Calc Valuation: Sz,000.00 Claim Valuation: 3z,000.00 PLANNING 8 ZONING Left 0- 0 Right Left 0- 0 Right Proposed: 0 . NOTICE: The work authorized by this permit shall compy wflh all applicable handicap access requirements under Califomia statutes and related regulations. (Ord. No. 92-28, § 1, 12-21-92) EXPIRATION: Thls permit shall automatically expire and become voitl if work is not commenced within 180 days, or if work is suspended or abandoned for a pedod of 18o days. INSPECTIONS: In order tor Ihe work authorized under this permit to be considered legal, such work must comply with all applicable codes, and all required Inspeetlo�e and tinal approval must be obtained. Failure to obtain inspections and tinal approval will result in the expiration ot this permit. FOR INSPECTIONS CALL: (714) 754-5828 zaase �eroo� WORKERS'COMPENSATON DECLARAnON: � � I hereGy eifirtn untler penalry ol perjury one of the following declaretions: ❑ I have end wlll malntain e certllicata at cpnsent to self-Insure tor workers' compensa�lon, es provitletl lor by section 3700 of lhe Lebor Catle, for the peAormence of the work tor whiCh Ihi9 permlt IS ISsueA. ❑ I have eM wi0 maintain workers' comper�� inwrancq. ¢5 requlretl hy sectlon 3700 oi the Lehor CoOe. for Ne perfortnar�ce ot Ne wwk iw whkh thLs pertnit is Lawed. My workers' compensatlon Insurence cerdar entl poliry number ere: Cerrier: Polity Number: (7his secrlon need not be canpleted i! fhe permi( 75 velvea ef one hwMred ddlers ($100) or Ie55J ❑ 1 cenily that In Ihe peAortnence oi the work lor which Ihls pertnit is issuetl, I shall not employ eny persan In eny manner so as to becoma subject ta Ihe workers' compensatlon laws af Calilwnle, end egree t�at tl I shaultl become subl�� o Ne workers' compensetlon pmvisions of Section 3700 0l ihe lebor Code, I s�all torthwith wmply with Ihese provlsions. Applicent Signeture: Dete: WARNINO: FAILUFE TO SECURE WORNERS' COMPENSATION WVEMGE IS UMAWFUL AND SHALL SUBIECf M! EM%.OVER TO CRIMINAL PENALTIES AND CML FlNES UP TO ONE HUNDRED T/10USAN0 �OLLARE (f100,000� IN ADORION TO TF1E W5T OF ODMPENSATIIXJ, DAAIAGES AS PROVIDED FOR IN SELTON 3108OF THE L1BOR CODE, INTEREST. AND ATTORNEI^S FEES. LICENSED CONTRACTORS DECLARATION: I here6y aHirtn thet I em Ilcensetl untler provisions of Chapter B(commendng wlih Socilon 7000) ol Dlvlsion 3 al the Business enA Professions Cotle, entl my Iicense Is In tull force entl eNecl. Lic. M Cless a Conirectots Signeture: Daie: CONSTRUC710N LENDING AGENCV: ❑ I hereby afllrtn l�el Ihere Is a conslructian lending apency tor t�e pertormance ol the work Por which this pertnit Is issued. (Sec. 3097, CIWI Cotle). Lentler's Name: Lendefs Adtlress: Signeture: Date: OWNER-BUILDER DECLARATIONS: I hereby eNlrm Ihet under penalry of per�ury NaI 1 em EXEMP7 FROM TNE CONTRACTORS LICENSE LAW tor the following reason (Sec. 7031.5, Business antl Protesslons Coae: Any Gry or counry w�lch requires e permit lo construct, elter, improve, tlemdlsh, or repair eny structura, prior ro its Issuance, elso requires the epplicant tor suc� pefmit to ille e signed slatement t�a� he or she Is Iicensed pursuent to Ihe O��ons ol the Contrectors License Lew (Cheptar 9(commendng with SecUon 7000) ol Division 3 of Ne Business end Profes5ion5 Code) ar that he or she is exempt theretmm entl the besis for the alleged exemption. Any violation of Section 7031.5 Dy eny epplicent for e pertnit subj cis the appllcant to e dNl penalry ol not more than frve hundred ddlers (S500j.): � I, es owner oi the properry, or my employees with weges as thelr sde compensatlon, WILL DO THE WORK, and the siruciure Is not inierbetl or oMeretl lar sele (Sec. 7044, Business antl Professlons Catle: The Contractors License Lew tloes not epply to an owner of propeny who builds or improves tharaon, and who tloas such work himself or herselt or I�roug� his or her own employees, providetl thet such Improvemenis era not intended or aflered br sele. If, however, the building or impmvement Is sold within one year ol completian, the ownar-builder vrill have the burtlen ot proving that �e ar she did not build or improve tor purpose ot sale.). ❑ I, as owner ot lhe property, em EXCW$NELY CONTRACTING WITH LICENSED CONTRACTORS l0 consiruct the pmject (Sec. 7044, Business anA Prote55ions Code: The wntrectors License Lew does not appty ro an owner ol property who DUIICs or Improves thereon, end who contracts for such project with e contrector(s) license pur5uent to the Cantraaars License Laws.). ❑ I em exe ntler c Signature: Owner ID verllletl y tlrivers ❑ No Business end Pmlessions Code br this reeson: Date: � 9^ /7 u 2 DdvefsLlcenseNo. � Expires:7-/7-�� Verilicetion ot Ownership by (type of document, i.e. - property la< �ill ar deed): DIVISION OF INDUSTRIAL SAFETV VERM17 CER7IFICATION: ❑ I hereby cenify that no excavatlon tive (5) or more feet In depih Into which e person is requlred Io descend, will ba made in connection with work euthotlzed by Ihls parmit, end that no bulltling swcWre, sCeryolding, falsework, or tlemolition or dismentling thereot, will be mora �hen ihirry-six (38) leet high. (Chap. 3.2, Gry 2, A� 2, Sec. 341, 71t1e 8, Celifomia AdminlslratNe CCWe). ❑ As owner-builtler, I wiil nat employ enyone to tlo work which would requlre a permit Irom Ihe Divislon ol Industriel Safery, es noted ebove, unless suth person hes e pertnit to do suc� work tmm t�e division. Signature: Date: Division ol Industnal Salery Permit Number: CERTIFlCATE OF COMPLIANCE M1D AUTHORIZA710N OF ENTAV: I cenify under penalry ot perjury thal I have read ihis appliwtion and state thet the Inlormation given is correct. I egree to comply with ell stece lews en0 city ordlnances releting to bulltling wnstruction, antl eNhorize representatives oi the City ot Casta Mese lo enter upon the ebove-descnbed p�� fyr inspe�n purp0.agr� � egree not to occupy or ellow occupanty oi eny building aulhorizeA by this permil until fnel ins0ection. �4PE,J. INSPECTIONTYPE 1816 Fixetl System Finel Fire Preventian 1288 Paol SOe Flnel 200 Finel Re-Rool 201 FInaI BIocWF±eteining Well 202 Final Fectory Flre Place 203 Finel Sipn 204 Finel Domolilion p� �" �QQ� INSPECTIONTYPE 208 Finel Mechanicel 20B Finel Plum�ing 210 Final Electrlcel 212 Finel Flre Prevention 220 222 250 Finel Planning ApP��'al Finel Site Finel Builtling/Occupancy [?Date �7_ ��' OZ Date QAg It�LB � �-d '� � NL (714) 754-5273 • Fax (714) 75a-4856 • www.ci.costa•mesa.ca.us 77 FAIR DRIVE, COSTA MESA, CA 92626 BUILDING PERMIT AT THI: Plan Check: $0.00 Permit: $97.25 SMIP Res: $0.50 SMIP Com: $0.00 Other: $0.00 Inspection: $0.00 Total: $97.75 Job nddress: 324 E 20TH ST Suite: Viciniry: WEST SIDE APT BLDG Parcel Number: 42622140 Zoning: Applicant: GRAND PACIFIC ROOFING COMPANY Adtlress: 8766 SAN FABIO CA Phone: (714) 220.0711 BUENA PARK Zip: 90620 Owner: NIEUPORT INVESTMENTS Address YoLANC0INVESTMENTS THOUSAND OAKS, CA Phone: 1394 E HILLCREST DR Zip: 91362 Contractor: GRAND PACIFIC ROOFING COMPANY Address: 8766 SAN FABIO CA Phone: (714) 220-0711 BUENA PARK Zip: 90620 License: 741260 Arth : Address: Phone: Eng: Address: ISSUED BY: Status: ISSUED Applied: 09117/2002 Issued: 09/17/2002 Phone: Zip: License: License: SCOPE OF PERMIT SETBACKS MAIN STRUCTURE Front 0- 0 ACCESSORY Front 0-0 PARKING Existina: o Rear 0-0 Rear 0-0 Reouired: 0 ree aummrarcr PLANNING & ZONING Left 0- 0 Left 0- 0 Proposed: 0 Calc Valuation: Claim Valuation: Right ' 0. 0 Right 0- 0 53,100.00 $3,100.00 NOTICE: The work aulhorized by this permit shall compy with all applicable handicap access requirements under Calilomia statutes and related regulations. (Ord. No. 92-28, § 1, 12-27-92) EXPIRATION: This permit shall automaticaliy expire and become vold if work is not commenced within 180 days, or II work is suspended or abandoned for a period ol 180 days. INSPECTIONS: In order tor ihe work authoriietl under lhis permit to be considered iegal, such work must comply with all applicable codes, and all requlred Inepeetlone end final epproval must be obtalned. Failura to obtain inspections and final approval will result in tha expiration ol this pertnit. FOR INSPECTIONS CALL: (714) 7545628 tsos�e �aroo) WORKERS'COMPENSATON DECLARAnqN: � I hareby effirtn under penalry of perjury one oi the fdlowing dedarailons: ❑ I have end wlll maintain e ceNficele ot cpnsent to selt-Insure for workers' compensatlon, es provltletl Por Dy sectian 3700 of tha LaDor Cotle, tor t�e peAormence of the work for wNcn cnis permit is issuetl. �, �have entl will meintain wOrkers' compen�g�pn Insurence. av requiretl by sectian 3700 ohlie Lebor Catle. br the perfortnence of Ne work tor whkh NLa pertNt Is Lssued. My workers' compensatlon Insurance cerder end policy numbar ere: Carder: PoliCy Numbec (Thls section need nof be cwnpleted i! fhe pemti(!g vglued et one huntlred tld/ars (5100) w IessJ ❑ I certity ihat In t�e pertormance ol Ne wOrk tw whlch Ihis pertnit is Issued, I shall not employ eny person in eny menner so es to become sub�ect lo Ihe workers' compensetlon la of Celifomia, end ree lhat il I sl u10 becyyymmm e sub�ecl to Ihe workars' compensellon provisions of S�on 3700 of the Lebor Code, I ahell foMwith comply wit� t�ese ro on � �� I O� Applicam Sipnature: � Dete: � WFRNINO: FAILURE TO $ECUFE ORNERS' COMRpp! ION COVEfUOE IS UMAWNL AND SWLLL SU&IECT AN EMPLOYER TO CRIMINAL PENALTIES M1D CNIL FlNES UP TOONE HUNDRED THOUSANDOOLURE�S100,000),INAODfTIONTOTF�E TOFGI�MPENSATIIXJ,DAMAGESASPROVIDEDFORINSECTION31080FTHElABORCOOE,IMEREST,ANDFiTORNEV'SFEES. LICENSED CONTRACTORS DECLARATON: I hereby efllrm ihat I em Ilcansed under pmWsions ol C�apter 9(mmmendng wlih Section 7000) of Dldsion 3 al the Business entl Pmfessions Catle, end my Iicenae Is In tull torce and eflect. U0. M CIe99 M Cantractofe Signewre: Dete: � ( '��%Y% i CONSTRUCTION LENOING AGENCV: ❑ I hereby eHirm Ihe� Ihere i5 8 con5truciian Ientling egency tor Ihe peAortnenCe ot Iha work for whiCh �hi9 perml� is 155uetl. (Sec. 3097, Civil CoOe). Lendefe Name: Signeture: _ Lendefs Address: Dete: OWNER•BUILDER DECLARATIONS: I hereby afllrm thal untler penelry at perjury thel I em EXEMPT FROM THE CON7RACTORS LICENSE LAW tor Ihe lollowing reeson (Sec. 7031.5, Businesa end Prolessions Cotle: Any ciry ar county which require5 e permit to canstruct, elter, ImO�ove, demolish, or repair eny structure, O�lor to It5 issuance, elso require9 t�e eppllCenl lor 6uch pertnil to Ille e signed slatemenl ihat he or she Is Ilcgnsed pursuent lo the proNsions ol tha Contrectors License Lew (C�epter e(wmmencing with Sectlon 7000) ol Divlslon 3 of the Business end Prolesslons Catle) ar Ihat he or she is exempl theretrom enA t�e basis for the elleged exemption. Any vlalation of Section 7031.5 by eny applicent br e pertnil sublecta t�e eppllcant to e civil penelry oF not more t�an tive hundred dollers ($500).): ❑ I, as Owner ot Ue p�aperty, or my emplaye¢y �vith weges as Iheir sole compensetion, WILL DO TME WORK, antl the struc�ure is not intentletl or oHeretl tor sale (Sec. 7044, Busfness anE Professions Cade: 7Fie Contractors LJcense Lew Cces not apply m an owner o( propeny who builds or improves thereon, entl who does such work himself ar hersetl or ihwugh his ar har own emplqrees, D�ovided i�et such Improvements are not Intentletl or oHered far sele. It, however, tha building or Imprwement is soltl within one year oi campletion, Ihe owner-builOer will have t�e burden of proving that he ar she did not bulld or improve lor purpose of sale.). ❑ I, es owner ot Ihe properry. am E%CLU$IVELY CONTRACTiNG WITH LICENSED CONTRACTORS to construct the prqect (Sec. 7044, Business end Professions Cotle: 71ie comrectors License Law tloes not appty m en owner ol property who builtls or ImO�o�es Ihereon, and who contracts lor such pro�ect wlth a contractor(s) license pursuant to the Contractors License Lewi�. ❑ I em exempt under sec. Business anC Protessions Cotle lor this reeson: Signature: Date: Owner ID veritied by Ariver's Ilcensa. ❑ Yes ❑ No DriveYs License No. Expires: Venlication ot Ownership by (type of documenl, i.e. - property tex blll ar AeeA): DIVISION OF INDUSTRIAL SAFETY VERM17 CERTIFICATON: ❑ I hereby cenify ihat no excavation five (5) or mare feel in depih Into whlch a person Is requiretl �o Cescentl, wlll be mede In connection with work euthotlzed by t�is permit, end that no builtling swcWre, sCeHolding, felsework, or tlemolltion or dismentling thereoi, will �e more than ihirry-six (38) leet hig�. (Chap. 32, Grp 2, Art 2, Sec. 341, 71t1e 8, Celltomia Adminls�retWe Cqtle). ❑ As owner-builder, I will not employ enyune to do work which would requlre a permit irom Ihe Divislon ol Industriel Sefery, es noted above, unlesa such person hes e permll b tlo such wark fmm Ihe division, Sigrreture: Date: Divlsion ol Intlus�rlal Sefery Pertnit Number: CERTIFICATE OF COMPLIANCE AND AUTMOR¢A710N OF ENfFiY: I cenity under penalry of perjury that I heve reaa this epplication anC state that Iha intortnation given is correct. I egree to compy with all state laws and ciry ortlinences relating to bulltling conswction, end authodze representatives ol Ihe Ciy of Costa Mesa to enter upon the ebove-descnbed property tor inspection purppses. I egree not to occupy or allow occupancy of eny Duilding euthodzetl by this pertnil until final inspection. CODE �. �xsveenoNTrve 1fi78 Fixed Sysiem Finel Fire Prevention 1288 Pool Spa Finel 200 Final Ro•Roof 201 Finul BIocWRetelnlnp Well 202 203 204 Finnl Fectory fire Plece Finel Sipn Finel Demolitlon Pdg ItffiIELS /D -7 2_-"'- ��' CODEI INSPECTONTYiE 208 Flnel Mahenlcel 208 Final PIum6ing 210 Final Eloctrical 212 Finel Fire Preventlon 220 Flnal Planning Approval 222 Finel Slte 250 Finel Buliding/Occupency � L�a`� � O� ate p7H .uul.lSl ' °s (714) 754-5273 • Fax (714) 754-4856 • www.ci.costa-mesa.ca.us P FAIR DRIVE, COSTA MESA, CA 92626 BUILDING PERMIT Job Address: 324 E 20TH ST Suite: Vicinity: EAST SIDE BUILDING - APARTMENTS Parcel Number: 42622140 Zoning: npp�icant: GRAND PACIFIC ROOFING COMPANY Address: 8766 SAN FABIO CA Phone: (714) 220-0711 BUENA PARK Zlp: 90620 Owner: NIEUPORT INVESTMENTS Address %LANCOINVESTMENTS THOUSAND OAKS, CA Phone: 1394 E HILLCREST DR Zip: 91362 ConVactor: GRAND PACIFIC ROOFING COMPANY Address: 8�66 SAN FABIO CA Phone: (714) 220-0711 BUENA PARK Zip: 90620 license: 741260 Arch : Address: Phone: Eng: Address: ISSUED BY: Status: ISSUED Applied: 09/17/2002 Issued: 09/77/2002 Phone: Zip: License: License: SCOPE OF PERMIT RE-ROOF MANSARD AREAS ONLY FOR AN APARTMENT COMPLEX. FLAT AREA NOT TO BE RE-ROOFED AT THIS TIME. Plan Check: $0.00 Permit: $57.05 SMIP Res: $0.50 SMIP Com: $0.00 Other: $0.00 Inspection: $0.00 Total: $57.55 SETBACKS MAIN STRUCTURE Fronl 0- 0 ACCESSORY Fmnt 0-0 PARKING 6cistinq: o Rear 0• 0 Rear 0. 0 Reouired: 0 FEE SUMMARY PLANNING & ZONING Lek 0- 0 Lek 0- 0 Proposed: 0 Calc Valuation: Claim Valuation: Right 0- 0 Right 0- 0 si,ssz.00 $1,562.00 NOTICE: The work authorized by this permit shall compty wlth all applicable handicap access requiremenis under Cali(omia statutes and related regulatlons. (Ord. No. 92-28, § 1, 12-21-92) EXPIRATION: This pertnit shall automaticalty expire and become void if work is not commenced within 780 days, or if work is suspended or ebarxloned ,, for a period of 180 days. INSPECTIONS: In order for the work aulhoAzed urWer this permit ta be considered legal, such work must eompy with all applicable codes, and all requlred Inspectlona and final epprovel must be obtained. Failure to obtain inspections and final epproval will result in the ezpi2tion of this permit. FOR INSPECTIONS CALL: (714) 7545628 2saBa81d�00) WORKERS'COMPENSATON DECLARAnON: I �ereby aflirtn untler penalry oi perjury wre at t�e tWlowing tleGaratlans: ❑ t �eve end wlll meintein a cenificate ot consent to sell-Insure tor workers' compensatlon, as provlded lor by sectlon 3700 0l ihe Lebor Code, for the peAormance of ihe work lor w�ich t�is pertnil is issuetl. �t have arM will maintein workers' compensatlon insurence, es requiretl by seclbn 3700 01 the LaEor Code, for the peAortnance o1 the work for which this pertnit is Issuea. �V My workers' compensetlon Insurence carrler antl pdiry number are: Cartier: PoliCy Number. (Thls secfion need not De wmp/eted il the perml( is ve/uetl et one hundred dollers ($100) or /ess.) ❑ I certity Ihat In I�e peAortnenca ol the wark tor which Ihis permit Is issued, I shell not employ any person In eny manner so as to become subject to tha workers' compansntion lews ol 'tomia, e groa thet II I shoulA bec � sub' el'%t�e workars' compensatlon provislons oi Sectlon 3700 of the Lebar Cade, I ahell lonhwith comptywiththe d i�� J' ^ _O /) ApplicantSlgnaWre: � Date: / �J WARNINCi: FA1 WFE TO�CU WOBI ' ENSATIIXJ GE IS UNLAW R1L AND 5lN11$UBJECT AN OYER TO CRIMINPL PENALTIES M10 CML FlNES UP TO ONE HUNDRED hKK15M1D DOILARE (5100.00OI.IN �DDfTION TO THE COST OF COMPENSATION, ON.UGES AS PROVIDED FOR IN SECfION 3]OB OF THE UBOR CODE, INfERESf, AND �TTORHEVS FEES. LICENSED CONTRACTORS DECLAFiA710N: I �ereCy aNirtn that 1 em Iicensed under provisbns brce end eNact. Llc. n� � Comrectors SlpnaWre: 8(commendng with Seciion 7000) oi D'Msion 3 af Ihe Business end Professions Cotle, entl my Ilcense Is In tull Glau a _. . __ . .... Date:. — — _ .._� . .� __ _..� l i�% CONSTRUC710N LENDING AGENCY: / ❑ I hereby eHirtn t�et there is e construction lending agency lor ihe pertortnence ol the work lar which this pertnit is issued. (Sec. 3097, Civil Cotle). Lentle/s Neme: Lendef5 AtlAress: Slgne�urB: Date: OWNER-BUILDER DECLARATONS: I hereby attirm Ihet under penelty oi perjury thet I em EXEMPT FROM THE CONTRACTORS LICENSE LAW tor t�e tollowing reason (Sec. 7031.5, Business end Protessions Cade: Any ciry or counry which requires e permit to conswn, alter, improve, demWish, or repalr eny siructure, prior to its issuance, also requiras the epplicant br such pertnit to tile a 51gneC stetement thet ha or she Is Iicensed pursuenl to the D�oWslons of Ihe Conirectors Llcense Lew (Chepter 9(commencing wilh Sectlon 7000) ot DIWs{on 3 ot Na Business antl Prolessions Code) or Ihat he or she I5 eaempt thereiran end the �asis for the ellegetl axemption. Any violetlon af Section 7031.5 by eny epplican� for a pertnit subjects Ihe epplicant to e cldl penalry at not more then five hundred dollars ($500)J: ❑ I, as owner oi Ihe properry, or my employees with weges as Ihelr sole compensatlon, WILL DO 7HE WORK, end Ihe siructure Is not intended or oNered lor sale (Sec. 7044, Business and Prolessions Code: The Conirectore License Lew tloes not appry to en owner ot property who bullds or improves Ihareon, antl who does such work himsalt ar herselt or through his or her own employees, provided ihat suc� impravements ere not Intended ar oMerad tor sale. II, however, the 6uilding or improvement is sold within one year of completion, ihe owner-builtler will have the burden of proving thet he or she did not build or Improva tor purpose ot sale.). ❑ I, a5 owner ol the property, em El(CLUSIVELV CONTRACTNG WITM LICENSED CONTRACTORS to construct t�e pro�ect (Sec. 7044, Business and Professims Cade: The contrectors License Law tloes not eppty ta an owner ot pmpeny who bullds or Improves Ihereon, and who conirec�s for such Droleci with e contractor(s) license pursuent to the Cantractors License LewSJ. ❑ I am exempt untler sec. Siqnatura: Owner ID verilied by dAvets Ilcense. ❑ Yes ❑ No Business and Professions Catle tor t�is reason: Venfication ol Ownership by (rype oi document, i.e. - property tax blll or tleed): DIVISION OF INDUSTRIAL SAFETY PERMR CERTIFICATION: Drivefs License No. Date: Expires: ❑ I hereby certlty ihet no excavation live (5) or mora feet In depth into whic� a person Is requlred to tlescentl, wiil be made in wnnection with work eut�orizetl Dy thls pertnit, and that no building sWcture, scaHoltlinp, lalsework, or demalition or dismantling Ihareol, will be more ihan Ihirry-sla (36) leet hiph. (Chap. 32, Grp 2, Art 2, Sec. 341, Tltle 8, Celllornle Atlministrative Cade). ❑ As owner•bull0er, I will not employ enyone to do work whiU woultl repuire e permit Irom the Divislon at Industrial Sefery, es noted ebova, unless such person has e pertnit to tlo such work trom the division. Signeture: Dete: Division ot Induslriel Sefety Permil Number: CERTIFICATE OF COMPLIANCE ANO AUfHORIZA710N OF ENfAV: I certify under penalry ot perjury that I have read thls applicatlon end state Ihet ihe Iniormatlon given Is correct. I egree to wmply wllh all state laws enG dty ordinences relating to building construcilon, end euthodze representatives ot the Ciry ol Costa Mesa to enter upon the ebove-describad property tor inspection puryoses. I egree not to occupy ar allow ocapancy ot eny building authorized by this permit unlil linel inspection. 40UE r. 1816 1266 200 201 202 203 204 Fixetl System Finel Fire Pi Pool Spe Finel Final Re-Rooi Finel BIocWRetelninp Well Flnal Factory Firo Place Final Sign Final Domalitian Pdffi It�LS /o—L2—e i� � � _ D t I � ' Date � COOE I INSPELTION TYVE 208 Flnal Mechanical 20B Flnal PIum6ing 210 Flnel Elec�rical 272 Flnel Fire Preventlon 220 Final Planning Approvel 222 Finel Site 250 Finel Building/Ottupency PAg It�l,4 (714) 754-5273 • Fa�c (714) 754d856 • www.ci.costa-mesa.ca.us 77 FA�R DRIVE, COSTA MESA, CA 92626 BUILDING PERMIT Job Address: 324 E 20TH ST Suite: Vicinity: POOL BUILDING Parcel Number: 42622140 Zoning: Applicant: GRAND PACIFIC ROOFING COMPANY Address: 8766 SAN FABIO CA Phone: (714) 220-0711 BUENA PARK Zip: 90620 Owner: NIEUPORT INVESTMENTS Address %LANCOINVESTMENTS THOUSAND OAKS, CA Phone: 1394 E HILLCREST DR Zip: 91362 Contractor: GRAND PACIFIC ROOFING COMPANY Address: 8766 SAN FABIO CA Phone: (714) 220-0711 BUENA PARK Zip: 90620 License: 741260 Arch : Address: Zip: Phone: License: Eng: Address: ISSUED BY: Status: ISSUED Applied: 09/172002 Issued: 09117/2002 Phone: License: SCOPE OF PERMIT RE-ROOF MANSARD AREAS ONLY FOR AN APARTMENT COMPLEX. FLAT AREA NOT TO BE RE-ROOFED AT THIS TIME. COVER POOL HOUSE MANSARD AREA WITH SIMULATED SHAKE. CLASS C MINIMUM. Plan Check: $0.00 Permit: $97.25 SMIP Res: $0.50 SMIP Com: $0.00 Other: $0.00 Inspection: $0.00 Total: $97.75 SETBACKS MAIN STRUCTURE Fronl 0. 0 ACCESSORY Front 0-0 PARKING Existinq: 0 Rear 0- 0 Rear 0- 0 Reavired: 0 FEESUMMARY PLANNING & ZONING Left 0- 0 Left 0- 0 Pr000sed: 0 Calc Valuation: Claim Valuation: Right 0- 0 Right 0-0 $3,100.00 $3,100.00 NOTICE: The work aulhorized by this permit shall compy with all applicable handicap access requiremenis under Calitomia statutes and related regulations. (Ord. No. 9248, § 1, 1241-92) EXPIRATION: This parmit shall automatically expire and become void if work is not commenced within 180 days, or if work ts suspanded or abandoned for a period of 180 days. INSPECTIONS: In order for the work authorized under this permit to be considered legal, such work must comply with all applicable codes, and all requlred inepeetlone and finel approval must be obtained. Failure to oblain inspections end final approval will result in the expiratlon of this pertnit. FOR INSPECTIONS CALL: (714) 7545626 240&IB (B�OD) WORKERS'COMPENSAnON D�CLARATON: � 1 hereby eftirtn under penalry of peryury one ot t�e tollowing declarations: ❑ I have and will mainteln a cerylfiwte oi consent lo selbinsure tor warkers' campensation, as provided lor by sectlon 3700 of I�e Lebor Cotle, for t�e peAormence of the �work for w�ich Itils pertnit Is iysuetl. ve end will maintain workBrs' campensatlon Inwrance, a9 requiretl by sedion 3700 0l the Le6or Cotle, tor the peAortnence ol Ihe work far whkh this pertNt is issuetl. My workers' compensatlon Insurence cerrier and policy number ere: Carriac '� � PoliCyNumber: (TT/s sec(ion need not be complete0 il Me permlf !s veluetl et one hundred dd/ars (5100) or less.j ' . ❑ I certify t�at in Iha pertortnanca ol Ne work br which tNs pertnit is Issued, I s�all nat employ eny person in any manner so as lo become subject to the workeB' compensatlon �aws ol Califomia, entl egree t� i tl I shauld becwne sub�ect t the workers' compensatlon provisions of Sectiory.�700 0l th9 � r O�rthwich comply with these pra ' /,j I Applirant Sipneture: Date: �� _ WARNINO: FAILURE TO SECURE Vji KERS' COMPENSATION OE IS UM.AWFUL AND SWLLL SUBJECf rW EMPIOYER TO CRIMIN�L pENALPES AND CML FlNES UP TO ONE HUNDRED hKKAWJD OOLLARE R��•�%• If! AOpiqH 7p7ryE W5T O OMPENSI�TION, UAANOES AS PROVIDED FOR IN SECiION 31080F THE UBOR CODE, INTEREST, ANO ATTORNEYS FEE$, LICENSED CONTRACTORS DECLARATION: I herehy aHirtn Ihat I am IlcenseG under proNsions ol Chapter 8(commendnp wlth SecUon 7000) of DMslon 3 ot Ihe Businesy entl Professlons Cotle, and my Ilcense is In tull torce enC eHeci. Lic. a Class a Conirectors Signeture: 7�� Date: � �� % CONSTRUC710N LENDINO AGENCV: ❑ I hareby eHirtn that Ihere Is e consWciion lentling epenry tor Ihe peAormance of the work tor whlch Ihis permit is Issuad. (Sec. 3087, qvll Cotle). Lendafs Name: Lendels Address: Signeture: OWNER-BUILDER DECLARATIONS: Date: I hareby eflirm Ihet untler penelty ot per�ury thal I em EXEMPT FROM THE CONTRACTORS LICENSE LAW tor Ihe lollowing reeson (Sec. 7031.5, Business end Pmtesslons Code: Any ciN or counry which requires e permit to cronstruct, elter, Improve, demolish, or repair any sWcture, pdor to its issuance, elso requlres the aOD��t for such pertnit to tile a signed stetemeN that he or she is Ilcensed pureuent lo Ihe pmvisions of tha Contractoro License Lew (Chepter e(commendng wlth Sectlon 7000) of Dlvislon 3 of Ne Business entl Protessions Cotle) Or thel he or sho is axempt tharefmm anA the basis for the ellegetl exemption. Any vialation oi Section 7031.5 by eny appllcanl tor e pertnl� subjecis the apPlicant to e civil penalty oi nat mare than tive hundred dollers ($500).): ❑ I, as owner ot Ihe D�aPerty, or my employees wlih wages as �helr sole wmpensation, WILL DO TME WORK, entl the structure is not Intendatl or oHeretl tor sele (Sec. 704a, Business antl Protessions Cade: The Contractoro License Lew does not epply to en owner of property who builtls or improves thereon, and who does such work himself or herselt or through his ar her own emD�%'ees, provitletl that such improvements era not intended or affered for sele. It, however, Ihe building or Improvement is sold within one year of completion, ihe owner�builder will have the burden at proving that he or she did not build or improve lor purpose of ule.j. ❑ I, as ov.•ner oi tha property, am E%CLUSIVELY CONTRACTING WIT11 LICENSED CONTRACTORS to construcf ihe project (Sec. 7044, Buslnesg flrM Prolessbns Cotle: The contractors LJcense Lew tloes not epply to an owner of pmperty who bulltls or Impmves therean, end who contracis lor such project with e caniractor(s) license pursuam to Ihe Contreqors License Lews.). ❑ I am exempt under sec. eusiness and Professians Code tor this reeson: Siqnature: Date: Owner ID verified by drivefs license, ❑ Yes ❑ No DriveYs LJcense No. Verifiwtion of Ownership by (rype ol document, i.e. - praperry tar bill or deetl): Expires: DIVISION OF INDUSTRIAL SAFETy PERMR CERTIFICATON: ❑ I hereby cenity thet no excaveUon five (5) or mora teet In tlepN into w�ich e persan is required to descend, will be metle In connection with work euthwized by this pertnit, antl ihat no builtling gtructure, scaHoldinp, telsework, or tlemolition or dismentling thereof, will be more Ihen thirty-six (38) tee� hiph, (C�ep. 3.2, Grp 2, Art 2, Sec. 341, Tille 8, Celifomia Admlqlslretive Cotle). ❑ As owner-builCar, I will not omploy enyone to do work whith would require e permit irom Ne Division oi Industriel Selery, es noted ebove, unless such person hes e pertnit to do such work from the di�risbn. Signature: Date: Divislon of Intlusirlal Satery Pertnit Number. CEB7IFlCATE OF COMPLIANCE qN0 AUTHORQATION OF EMAV: I certify under penalry ot perjury tha� I have read this epplicatlon antl state that tha Infortnatlon gNen is wrrect I egree to comply with ell ytate laws entl Gty ordlnences reletinp ta building wnstruction, antl authonza representatives of Ihe Ciry oi Costa Mesa to enter upon the ebove-described properry tor insp�ction purywes. I egree not to occupy or ellow accupanty of eny building authorizetl by this pertnit until linel inspection. COOE t. INSPECTIONTYVE 1616 Fiaed System Final Fire Prevention 1268 Pool Spe Finel 200 Flnel Re-Rool ' ( 201 Final BIocWReteining W411 202 Final Factory Fire Plece 203 Final Sign 204 FinalOemolifian P6IE ItII�LB (O�L2-o2 f-� ' I 1 °-Y� � Date QQQf�j INSPECTIONTYPE 206 Finel Mechanicel 20B Finel Plumbing 210 Finel Eledrical 272 Finel Fire Preventlon 220 Finel Planning Approval 222 finel Site 250 finel BWlding/Occupancy PAg U{I�dl$ ,(714) 754-5273 • Fex (714) 75a-4856 • vrxw.ci.costa-mesa.ca.us 77 FAIR DRIVE, COSTA MESA, CA 92626 BUILDING PERMIT Job nddress: 324 E 20TH ST Suite: Viciniry: SOUTH SIDE BUILDING - APARTMENTS Parcel Number: 42622140 Zoning: Applicant: GRAND PACIFIC ROOFING COMPANY Address: 8766 SAN FA810 CA Phone: (714) 220.0711 BUENA PARK Zip: 90620 Owner: NIEUPORT INVESTMENTS Address %LANCOINVESTMENTS THOUSAND OAKS, CA Phone: 1394 E HILLCREST DR Zip: 91362 Contrecror. GRAND PACIFIC ROOFING COMPANY Address: 8766 SAN FABIO CA Phone: (714) 220-0711 BUENA PARK Zip: 90620 License: 741260 Arch : Address: Phone: Eng: Address: ISSUED BY: Slatus: ISSUED Applied: 09117/2002 Issued: 09I17I2002 Phone: Zip: License: License: SCOPE OF PERMIT RE-ROOF MANSARD AREAS ONLY FOR AN APARTMENT COMPLEX. FLAT AREA NOT TO BE RE-ROOFED AT THIS TIME. SOUTH SIDE OF PROPERTY APARTMENT BUILDING. Plan Check: $0.00 Permit: $57.05 SMIP Res: $0.50 SMIP Com: $0.00 Other: $0.00 Inspection: $0.00 Total: $57.55 SETBACKS MAIN STRUCTURE Front 0. 0 ACCESSORY Front 0-0 PARKING Existin : 0 Rear 0. 0 Rear 0- 0 Re uired: 0 FEE SUMMARY Calc Valuation: Si,5s2.o0 Claim Valuation: S�,ss2.00 PLANNING 8 ZONING Lefl 0• 0 Right Left 0. 0 Right Praoosed: 0 0- 0 NOTICE: The work authorized by this parmit shall compty with all appllcable handicap access requirements under Califomia statutes and related regulations. (Ord. No. 92-28, § 1, 12-21-92) EXPIRATION: ThIs permit shall automatically ezpire and become void il work is not commenced within 180 days, or it work Is suspended or abandoned for a perlod of 180 days. INSPECTIONS: In orUer lor the work aulhorized under this pertnit to be eonsidered legal, such work must wmpty with all epplicable codes, and ell requlretl Inspeetlona and flnal epproval must be obtained. Fallure to obtein inspeclions and final approval will result in the expiratlon of this pertnit. FOR INSPECTIONS CALL: (714) 754-5626 2ad&te�&tl0) WORKERS'COMPENSAnON DECLARAnON: I hereby effirm untler penalry oi perjury one ol the lollowing deGareLons: �� 'r ❑ I heve end will maiNain a certifcate ol cansent to self-Insure br workers' compensetion, es pmNded for by section 3700 ot t�e Lebor Cotle, tor the peAormence of the � w/ork for whiCh IhiS pertnit I5 iuuBA. Ll/I l�eve end wlll maintain vrorkers' compenSaUon insurenca, es requlretl by section 3700 oi Ne Labor COAa, lor Ne pertortnance ot Ne wark for which Oris pertnit is iswed. �� My workers' compensatlon Insurence cartler end po0cy numher ere: Certier: f Poliry Number: (This secHon need not be complefed i! Ne permiN9 velued el one hundred dW/are ($100) ar Ie55.J ❑ I certify that in tha peAormence af tha work fOr w�ich this permit is issued, I shell not empla/ eny person In eny menner so as to become subject to t�e woAcers' campensation laws ot Calii la, anA ree th il I should become subject to the workers' compensatlon proNslons of Section 3700 of Ihe Lebor Cade, I shall forthwlth comply with these p io � CG f� _�/� /� � I/� �� Applicant Signeture: � j��C— Dete: �� — i W ARNINO: FAILURE TO SE E W RS' COTIPENS�?IpN COVE �I UNLAW FUL M1D SHnLL SUBJECT AN EMP�OVER TO CRIMINAL PENALTIES AND CM� FlNES UP TO ONE HUNDRE� THOUSANDDOLLARE(5100,000),IN/ DRIIXJTOTHECd$TOFCOM ;NSATION,OAA4IGESASPPOVIOEOFORINSECTION3]OBOFTHEIABORCODE,INTEFEST,ANDATTORNEI"$FEES. LICENSED CONTRACTORS DECLARATION: 1 herebyaNirtn thet i em lorce and ettect. Lic. N_ Conirector's SigneWre: Sec(ton 7000) of DlNston 3 of t�e Buslness end Professbns Code, end my license is fn (utl Cilfi99 k _. _ _ _ _ _ _._ _ oa�e: � CONS7FiUCTON LENDING AGENCY: ❑ I hereby ettirm Ihet there is e construcibn lending egency lor ihe pedormence of t�e work for w�lch Ihis pormil Is IssueO. (Sec. 3097, CiNI Cotle). ILendefs Nemo: Lendets Adtlress: Signelure: Date: OWNER-BUILDER OECLARA710NS: I �ereby ettirm that under penalry oi perjury Ihet I am EXEMPT FROM TT1E CONTRACTORS LICENSE LAW lor ihe tollowinp reason (Sec. 7031.5, Business end Prolessions Cotlo: Any ciry or counry which requires e permil Ib consWct, elter, improve, tlemolis�, or repelr eny alrucWre, pnor to Its issuance, elso requlres t�e eppllcaN Por such pertnit to flle e signed stetement thet he or she Is Iicensetl pursuani to t�e prmdslons of the Coniractors License Lew (Chapter 9(commencing with Sedlon 7000) ol DlWsion 3 oi the Business enE Professians Cade) or that he or she I5 eaempt t�erefrom and the basis for the elleged examption. Any violetian of Sectlon 7031.5 �y eny epplicent lor e pertnit su�jects the epplicant to e clvil penalry ot not more then fiva hundred dollars ($500)J: ❑ I, es owner of the properry, or my employees with weges es thelr sole compensatlon, WILL DO THE WORK, and the structure is not intentle0 or ottera0 for sale (Sec. 70A4, Business and Professions Cotle: The Contrectors License Law does not apply to en owner of properry who builtls or improves t�ereon, and w�o Goes such work himself or herself ar Ihrou9h his or her own emplayees, provided Ihe1 such improvemenis are not Intended or ottered lor sale. tl, however, ihe builtling or Improvement is sold within one year oi completion, t�e owner-builder will heve the burden of proving Ihat he or she did not bulltl or Improve for purpose of sale.�. ❑ I, as owner of the pro0erty, em EXCIUSIVELY CONTRACTING WITH LICENSED CONTRACTORS to construct the project (Sac. 7044, Business entl Protesslons Cotle: The coniracrors License Lew does no� eppty lo en owner ot properry who builds or improves ihereon, end who contracts for such project with e contrector(s) license pursuant to the Coniraaors License I�ws.). ❑ I em evempt untler sec. Signeture: Owner ID verilled Ey tlr'rvefs Iicense. ❑ Yes ❑ No Business end Professions Cade lor this reeson: Vedflcation ol Ownership by (rype of documeni, i.e. - property taz Dill or deetl): DIVISION OF INDUSTRIAL SAFETY PERMR CEq7IFICATION: Drivels License No. Da�e: Expires: ❑ I �ereby cenity that no excavation five (5) or more feel in depth Into which e person is required to Cescentl, wlll be made in connection with work aut�orizetl by ihis pertnit, end ihat no bullding swcwre, sceHolding, falsework, or demolition or tlismentling t�ereol, wl�l Oe more �hen thirty-six (36) teet high. (Chap. 32, Grp 2, An 2, Sec. 341, 71�1e 8, Celifornia Adminisiretive CoOe). ❑ As owner-buildar, I wlll not employ enyone to tlo work which wauld require e permit Irom the Divislon ol Indusidul Sefery, es noted ebove, unless auch person has e permit to tlo such wark tmm the divislon. Signeture: Date: Divislan of Indusirial Safery Pertnit Number: CERTIFlCA7E OF COMPLIANCE AND AUTMORqpTION OF ENfiiY: I certity under penalry ot perjury thet I have reatl this epplication antl state thet the infortnatlon gNen is correcL I egree to comply with all stata laws end ciry ordinences relating �o building conswction, entl auihodze representatives of the City of Caste Mesa to enter upon Ihe above�descdbetl O�aPerty far inspection purposes. I egree not to occupy ar ellow accupancy ot eny bullding authodzetl by this permit until finel inspection. CODE /. INSFECTIONTYPE 7618 Fixed System Final Flre PrevenUon 7288 Pad SOe Finel 200 Flnal Re-Roof 201 Flnel BIocWRetalning Wall 202 Flnal Factory Fire Place 203 Final Sign 204 Final Demalition QdIE Ilii�eLS �d .'L'L.O% � r- � /�ate � i I Date �E,( MSPECTIONTYVE 208 Flnal Mechenlcal 208 Flnal Plumbing 210 Flnal Eloctdcel 272 Flnal Fire Provention 220 Final Planninp Approval 222 Flnel Slte 250 Finel Bullding/Occupancy � It� (714) 754-5273 • Fa�c (714) 754-4856 • www.ci.costa-mesa.ca.us 77 FAIR DRIVE, COSTA MESA, CA 92626 BUILDING PERMIT Job Address: 324 E 20TH ST Suite: Vicinity: CARPORT BUILDING Parcel Number: 42622140 Zaning: Applicant: GRAND PACIFIC ROOFING COMPANY Address: 8766 SAN FABIO CA Phone: (714) 220-0711 BUENA PARK Zip: 90620 Owner: NIEUPORT INVESTMENTS Address %LANCOINVESTMENTS THOUSAND OAKS, CA Phone: 1394 E HILLCREST DR Zip: 97362 Contractor: GRAND PACIFIC ROOFING COMPANY Address: 8766 SAN FABIO CA Phone: (714) 220-0711 BUENA PARK Zip: 90620 License: 741260 Arch : Address: Phone: Eng: Address: ISSUED 8Y: Status: ISSUED Applied: 09/17/2002 Issued: 09/17/2002 Phone: Zip: License: License: SCOPE OF PERMIT RE-ROOF MANSARD AREAS ONLY FOR AN APARTMENT COMPLEX. FLAT AREA NOT TO BE RE-ROOFED AT THIS TIME. COVER CARPORT AREA WITH SIMULATED SHAKE ROOF. CLASS C MINIMUM. Plan Check: $0.00 Permit: $97.25 SMIP Res: $0.50 SMIP Com: $0.00 Other: $0.00 Inspection: $0.00 Total: $97.75 SETBACKS MAIN STRUCTURE Front 0. 0 ACCESSORY Front 0-0 PARKING Exislin : 0 Rear 0- 0 Rear 0- 0 Reauired: 0 FEE SUMMARY PLANNING & ZONING Left 0- 0 Left 0- 0 Proposed: 0 Calc Valuation: 53,too.00 Claim Valuation: 53,ioo.00 Right Right NOTICE: The work authorized by this permit shall comply with all applicable handicap access requirements under Califomia statutes and related regulations. (Ord. No. 92-28, § 1, 12-21-92) EXPIRATION: This permit shall automatically expira and become vold if work is not commenced within 180 days, or If work is suspended or abandoned lor a period of 180 days. � INSPEC710N5: In order for the work authorized under this permit to be considered legal, such work must comply with all applicable codes, and all I requlred inepectlons and final approval must be oblained. FaiWre to obtain inspections and final approval will result in the axpiration of this permit. I FOR INSPECTIONS CALL: (714) 7545626 _ zaae�e �am) WORKERS'COMPENSAnON DECLARATON: � I hereby aHirtn under penalry ot perjury one ot the fallowing tleGaretions: ❑ I heve antl will mainteln a ceniticete of consent b selt-Insure tor workers' compensetion, as provldetl br by section 3700 of Ihe Labor Code, tor the pertormence oF ihe work tor which this permit Is issued. , I have an0 will maintain workers' compensation Insurance, es required by section 3700 o/j,'he Lebw �o0e, for the performance of the work for which Nis permit is issued. My workers' compensation Insurance carrier end poliry number ere: Carner: Policy Num�er. (Th/s sectlon neetl not De completed i! fhe permit is valued et one hundred dollers ($100) or less.) ❑ I certity that in the peAormance oi the work for which thls pertnit is issuetl, I shell not employ eny person in any menner so as to become su6joct to ihe workers' compenseiion laws of Califomla, antl egree tha It I should becoma subl�� he workers' compensatlon provislons ot SedlO� 00 of Iha Lebor Cotle, �e orthwlih comply with these provisim'�,� ^/ ApplicaNSigneture: ��'�'�� Dete: � � I � WMNING: FAILUFE TO SECURE WORKERS' COMPENSAT1dJ WVE GE IS UNLAwFUL AND SHALL SUBJECT PN EMPLOYER TO CRIMINAL PENALTIES AND GVIL FlNES UP TOONE HUN�RED THOUSAND DOLLARE (5100,000), IN ADDITION TO THE COST OF CQUPENSATION, OAMAGE$ A$ PROVIDED FOF IN SECTION 31060F THE LABOR CODE, IfJrEREST, AND ATTORNEI"S FEES. LICENSED CONTAACTOFiS DECLAfiAT10N: I hereDy aNirtn thal I em licensed under provisions at Chepler 9(commencing with Seclion 7000) of Divisian 3 of the Business and Pmfessians Cotle, antl my Ilcense is in full forca and ettect Lic. M_ �. / _ / Cless a ___. .. Cantrectofs Signeture: Dete: CONSTRUCTION LENUING AGENCY: ❑ I hareby ettirm thet there is e consWdion lentling agency br �he peAormance oi l�e work br which ihis permit is issued. (Sec. 3097, CiNI Cotle). Lentlers Name: Lender'S Address: Signeture: Date: OWNER-BUILDER DECLARATIONS: I hereDy aHirtn that under penelty of perjury Iha� I am E%EMPT FROM THE CONTRACTORS LICENSE LAW for the follawing reeson (Sec. 7031.5, Business and Professions Code: Any ciry or counry which requires a pertnit to construct, alter, improve, Aemolish, ar repair eny strucwre, pnor to Its issuance, also requires the applicani for such permit b tile e signetl statement that he or she Is Ilcensetl pursuant lo the provisions ol the Contractors License Lew (Chepter 9(commencing with SecUon 7000) of Division 3 at ihe Business end Professions Code) or Ihat he or she is eaempt therefrom and t�e basis for the elleged exemption. Any violation of Section 7031.5 by any applicant for e permit subjecis the applicent to e civil penalry oi not more than tive huntlred tlollere ($500).): ❑ 1, as owner of the property, or my employees with wages as their sole compensation, WILL DO TME WORK, antl the siructure Is not intentle0 or oHered tor sale (Sec. 7044, Busineu antl Professions Code: The Contractors License Law does not apply to en owner ot property who builds or improves thereon, antl who does such work himselF or herself or thmugh his or her own employees, pmvided thet such improvaments are not intended or ottered for sale. If, hawever, the builtlinq or improvemem is sold within one year of complelion, the owner-builder vnll have the burden ot pmving that he or she did not build or improve for purpose ol salaJ. ❑ I, as owner of the pmperty. am EXCLUSIVELY CON7RACTING WI7H LICENSED CONTRACTORS to constmct the projecl (Sec. 7044, Business and Professions Cotle: 7Te contractors License Lew does no[ appty to an owner oi pmperty who builds or improves thereon, and who contracts for such pmject with a contrador(s) license pursuant to Ihe Coniractors License Laws.). ❑ I am exempt under sec. Business and Pmfessions Code for ihis reeson: SignaWre: Date: Owner ID verifled Dy tlnvefs Iicense. ❑ Ves ❑ No Dnvets Ucense No. Expires: Vedticetion of Ownership by (type oi dwumem, i.e. - properry taz bill or deed): DIVISION OF INDUS7HIAL SAFETV PERMIT CERTIFICATON: ❑ I hereby cenity ihat no excevauon tive (5) or more faet In Oepth into which e person is requiretl Io tlescend, will be made in connection with work authorized by Ihis pertnit, and that no bullding strucWre, scattolding, lalsework, or demolition or dismantling ihereof, will be more Ihen thirty-sla (36) taet high. (C�ap. 32, Grp 2, Art 2, Sec. 341, Ttle e, Celifornia Adminisirative Code). ❑ As awner-6uilder, I wlll not employ anyone m tlo work which woultl require a pertnit tmm Ihe Division of Indusiriel Safery, es nated above, unless such person hes e permit to do such work trom ihe division. Signeture: Date: Divislon of Industnel Satery Pertnit Number: CERTIFICATE OF COMPLUWCE AND AUTHORIZA710N OF ENTRY: I cenity under penalty of perjury ihal I have read Ihis application antl state that ihe infortnation given is correct I egree to comply with all state laws flnd ciry ordinances relating to builGing construction, end authodze represematives of Ihe Ciry ol Costa Mesa to enter upon the ebove-descnbad property tor inspection purposes. I egree not to ocapy or allow occupency ot any builtling authorized by this permit until final inspection. CQOE �, INSPECTIONTYPE 1616 Fi:eG System Final Fire Prevemlon 1266 Pool SDe Final 200 Finel Re-Rooi 201 Finel BIocWReteining Well 202 Finel Factory Fire Place 203 Finel Sign 204 Final Demolition QAIE It�Li p i'L4,�0'L .�i// ,A�_� CODEI �xsveenoNTvre 206 Finel Mechanical 208 Flnel Plumbing 210 Final Electdcal 272 220 222 250 '� D�� Date Finel Fire Preventlon Finel Planning Appraval Final Site Final Building/Occupency PAIE II{�IELS �ooness a eutm+E :7 L 4 h L V ZFl 5 I avrnxsruYeivanwrt LANLRY�_LAtiIU .00xess: 3� 4 h L V 1 ti J 1 it 3 CuSTA MESA,CA JLbLb " b95-u574 �vv�. wmwo �ooxesx �APCXIfEtt OR ENCd/HA: IiPCIl011 FN6'4 �OORE53: c�m��Tarsru� MIKE LAkA kOOFING ewm�croas�uiwe 155 S FEPPEk Si uxt: :! 11C Iq: U1�f: (714)e39-831� ,�op� ORANGE CA ��, 7332%4 9 2 8 6 8 �,,,, LICENSED COMXACTOPS OECL�PITION: I hareby eflim iiMer penety d pajury Nel I em Icenved uMr pa.'vime d Cheqr 9 (mmme�nY wnh Seciion )000) d Oivieion 9 d tlre Buamsa arW Pmlmdons Code. end mY 4oaree e in lup brta eM Nled. cmuc.No_.:1 uc.cuss: C39 uc.No.Q: 733274 EXP: Dms: � 1 lIT/ D�� Caqmdoc I I.i� �� OWNEP BUILDEfl UECIANATION: I hreby dfirm ivder pmdy d pmjm� ihel I em ewnq hom ihe Cap�etlm Lioema law la iM �dbv.6i0 reason (Saabn l0�ls Buviwse vd Rdmeine Coda: MY W a muav xAiN repws . w�i to mmeua. Wer. Inwwe. nd'eh, a npei ury sVuelure, prur b ea evuenee, abo reVuiem iM epplimM In acl� pemil to fiM e eproA paiemeN Nel M a ehe Eemed W�� o Ihe pwivam tl Ne Conlratlon licertx law �Cheqm 9(mmmene�p wu� Swion MW) d Onreion 3 d tb Jainen enE Prdmaime Codel n Ihd he a ehe ia examp �herehan eM iM batie ta IM dk6� exemAion. MY violmion d Seaim lVlt.S Ey aery eppirani for e pmmil wbjeae Ihe epWieenl lo e ail penehy d ewl mae �hen Ma huMrad dd4n �SSOOp. � 1.uownerdiMqopenyormyempbywewlhwepesaviheiademmpaneatim,willdathework,aMNeeVucluncrwintaMed or aflered lor sele (SecUon ]OCC. Bumnev eM Pmlesaioru Code: The Contrmaa Limrtve law Eme nd eppyto en ownerd popeity who buitla a inqwae thereon, vd x1w daea auM wak himaetl a Mne� a Mrouph he a her ovm empbyse�, po+ided thm wW impwemanb ua rwi imendeE a allmed la eda. tl. lawever. the Wikiiq a inpv.emem a satl wilhin one Yw d mmpletun. Iha awMr-0uiHer Mill M1eve iM1e burdm d proviip he a ehe d'd M WlE a imprv.e la tM qvpwe d Wa�. � 1. u awmr d �M OAPaM. em uduinN mntradM wnh liemed canuec�on io cmmue the pel� (Seaon rol�. Bueineee enE Prdaubm Code�. TM Caniradas l'swe Lew Cros na xDP�Y w en owner a O�OeM Ma bui16� «"unpwa tlwaon ud w1a eonveeia M wdi peqeas xiN e mMetloH+) lieeroed WB� to iM Comrmoea L'vue law). � I em eaemq wdar Seciion: B. 8 P C.. tar Nie reeam: ome: o,� I Ao Mmby cenAy Nel I em eware d eM uMentvk Ma repuiremema d Celdamie Heellh vM Selely Code Sediom 25505, 25533, vM 25531, enE Ihet I a eny Mun Wildinp ampenl will I wil �wl (rircb one) meE lo comON w�� e wdm erd tM reQuimmenb M epermnbrmnatruelionamodifieelimhomiMR'r uaaTiTyl�anegemeniDislna.Raideruielmn�rudioneppieqqeroeramemptlrom�Mee provisiane. Deta: /pWcaM: wonKen•s cowavu�na+ oEcurunoN: � nercM eKvm �Me. n.rony a pajwy on. a me �aw.;iy e.a.mlo�.: F � IhevaeedwilmeiMeneeMXktleGmneenitoaellinwreforMv�kenoompemmon.mprovidadlabySanbnJ]OOdtMlabor Cods.la Ihe pmtamence d Me wak la wlic� tlib pamil b 6aueE. ❑ �neveenawi�meimen.ona.•mmv�:M��.%+�wN�eWs.aimaroodm.�.no,wee.bmew+«�wwsdm. work la which ihie Pa�mil o usued. MY wvFan' mmGa�tion ineweiws umer end Vdi,y number ve: - c�«: Polcy Number: n sMion need nw he comPlxed d tM pemiA is lor one hunCreLCdlers /SIDJI a Im.J �I mrl/y ihm in Ne perlormenu d Ihe work /a whc� Iho Po�� ie beueE. I ehell iwl empby eny penon In eny men�ror o n to becane eubjea �o �he wvkere' compemeiion lewe al Calilanu. uM eprae thm it I ehautl becoms wqae io tM xwken' � ` compena an pwi. iom d SeUion 3]00 d tM Lebor Cade. I ehdl lon wnM1 com '�aau. y Dma: Apd�� / W�mllp: FeNu ro we n wNcen'rompwuetlon eovwaps /� un/aw�Nl, eM NWI ub�er! en w�nplay.r roWMnl puWtlr aM dw nnu w ro ms nurer.d rrouwna adrn lt�aloaA b��n ro m. m.r o� romaen.edoq e.m.o.. u provtew ror in s.cuon aros o� m. leao. coa, �mwt .�e.mms�'. r.... CONSiNUCT10N LENOINO �OENCY: I M1saby etfi'm uMer peiuM1y d perjury ihet ihsa u e mngruqion bMiry epric� M tM paAamerce d IM xak fa which �h'v pami ie oaued (�� ). C'v. CI. LENDEN'3 NANE: LENDEF'S ADDPE53: I ceniN �� I heve reed thia epplicmion and me�e ihet tlw ebove iniamelbn ia conw. I ep�ae io canpy wuh eA ary erd munry adirorcee uM eltle lewa releliq b WiWip canNutlbn vd hereby eulhorrta iepuen�etivee o11hb cily W emx upan iM aDv.e-monlnnsd popeM r«��oea�wm�. �1hSIEN LtIAA \i /K � Dma: _��L{�� rsb�mwe a m,.wi oa�ucon��aw � (StStJe.WP) While-BuiknpBSelely:0�earFb:Genary-Appfunl:Rnk-Peven�e:GdEervoE-b�eev �IIii Gr COSiA M65A - bUIi,uING PEttMIi rEFcM NG: H 08531- PERMIi NG: b u8531G FLAN CHECF NG: N GGVi; N SUYY; N CuNSTRUCTIGN iYPE: FERMIT TYPE: S'Ik PUnPt�Sr.: i�Iri JUb LESCRIPTIGN :'TiGFF SiiEA'IH S RERGGF AS Ne;e.LEL SQ tI: S,OGu CLAIM VAI,iJE: S,OG"v.OG CALC-VALUE: 7,G"vO.G'v GROUF Oi;C; U-1 i COMMY:NTS: AEAOGF CARPOhrS W/bUILT-UP iE if iE iF tii� iF iF ie si if iF it if iF ii ii ii ii iiiF ii iF if iF i'r iE if ie iEie ie wiEiE i'e iF iE if ii ieie if ii ii iE ie ie ieii ii se ii ii'seii ii iEie ie'si ii iF ie ie i't're tii iFif iF ii iiif iF ie i'r ie ie'vF Z O N I N G A E Q U I R E M E N T S S E T b A C K S ------------ MAIN BUILDING ---------- --------- ACCESSORY" BUILDING --------- FANT: FT IN REAA; FT IN FRNT: F'T IN REAit: FT IN LEFT: FT IN AGHT: f'T IN LEFT; FY IN RGHT: FI IN PAAKING REQ • PA�JV; �ARCEL: GOGOGGGG 'LNE: REF NO: PLANNING NGI'ES> � % iE ii ir #rt if ii iP iF iF it ik k M R ii w iF ii if if ie if ie iF if 1f iF vF iF w ie iF'sf ie±� iF ie iP iF iF iF iF if 'sF if iF if if 3i i4 it �f it if ii if iF ii iF i'r iF iF w w si �e i4 ie iF iF 3'r iE i't iF if ii ii iE D E V E,L O P M E N T S E R V I C E S R E Q U't R E M E N'f S ZUNING AP�ROVEU. BY 1iATt; ,.e BUZLDING APFRGVEL bY ; LATE: i� APFLICATIGN ISSUED bY; L11T�.: �� Zb "�� 3FiFiFwi'tifiEiEiFifiEifiFieiFlFiFiFiFiiiFifsFiFiFaexfeyF±e�FsF3e7isF%sFsFseiFiF7iiF�F'iFi' xiise"iFiiirvFifwiFiFiFiFiiif�FiF3E�st'£iiie LEGALIZATIt�N:N F E E S U M M A R Y STRUCTUC2AL S�:GMENT;z bLLG PMT PLUMSING ELECiRiC MfiCHANIC FZRE *'SMIPiR�.S �kALING FERMII' 99.75 ,50 PLaN , ISSUE FEE bUILD2NG-LZV-> PEhMIT ISSUE PLAN-CHECK TOTAL FAIL u0E TO'IALS----> 100.25 0,00 O.GO lOG.25 - 10u.25 ,OG REVENUE DIVISIGN TOTALS--> COLLECTED: 100.25 UVERiSHURT; .uu BLUG pMT PLUMbING ELECTRIC MECHANIC FIRE SMIF/'!UT-,iGRADING PLAN-CHfiCK 99.75 ,SG.. iF iF ii ie iF iF'vi # iE iF iF iF if iF ie ii if if 1F ii if if ii ii ir iF if �e K iF # 3F iF iF if ii iF ii iF iF iF if iF if iF �lF iF iF if if 'tF iF 3F'se iF if i4 it ie i'r #+F' iF iE ii 9F if'r't iF �k if * i<ie ie i?�w�k ii I N L I V I D U A L F E E 6 R E A K L G W N TYP�. SFR QTY L E 5 C R Z P? I u N Su00 RERGGF bY VALUE RBSZLt.NTIAL NG�GN�. tNL GF FE�:S UNIT CGSZ 'iGIAi, i:GSI 1:UU �,VVV,VV ,/ ., "�}, • �IB-2B-1997/B8:4B qM/fIB8.25 . RCDTN:81-6814899 PERMIT:985310 /' �NSTRUCTION AND PLANNING FOO SPA APPROVALS Permit# Date Inspector AppROVALS Permit# Date Inspector 1. Temporary �lec2rical Service or Poie 52. Pool & Equipment Locatiun� - 2. Soil Pipe�Undrgmd. :-,, � 53. Steel Reinforcement . � � 3. �lectrical Conduit Utility-Undrgrnd. 54. Forms -�� - � 4.,Electrical Conduit�Undrgmd. , 55. Electricai 8onding �5�.,Steel Reinfoicemeni � 56. Rough Plumbing & Pressure Test - "-' 6;'�Electritai UFER C�md. 57. APPROVAL TO COVER•GUNITE - �u � :; r ... , 7} -F�`ootings - 58. Electricai Conduit-Undrgrnd. y 8. Foundation �� -� � � 59. Gas Pipe, O Undrgmd., Test x 9..Water Pipe�Undrgrnd.- : 60. Backwash Lines, P•Trap, O Undrgrnd. 10. Structurai Floor Svstem '% 61. APPROVAL TO DECK . 11. �Property Sewer Line & House Connection 62. Backwash & Receptor-Final 12. Sewer Cap �� .� ' 63. Heater & Vent-Final �� 13. Roof Drains .`� 6A. Plumbing SYstem - Flnat ., 14. Rvugh Plumbing 65. Electrical-Final 75. Rough Electricat-Conduit _ 66. Solar SYstem-Flnal _. � i 6. Rough Electric:Wiring 67. Fencing & Access ApAroval - . 77. Rough Wirin� Sign 68. APPROVED FOF PLASTERING � 18. Rough Electrical-T Bar Ceiling - 69. PQOL/SPASYSTEMS FINAL 19. Rough Hea'ting & Air Conditioning FIRE DEPT. REQUIREMENT � - n .-i - iT -1 Y, 20.!�iou�h F�ctojr'Y F�e�lace � j�" �S '„ �_ APPROVII�$,'�� Pe�.J'mit #` =____'r 21.��Ducts, irrStracture • � •• , S ` K " � a '. 70:-Under'gieq?d 13�ydro " c' . � .l .'1 w 22.Dutti,Ventilating',� "� }_ y. �z` 77,Jprodu0t?iping�C�Gas �70i1 23.'Gas ��ipe_Rough & fest � r S �.n �� v�-� 72. Undergfound Ftusl}+ w -• � � 24. 'flooT� Fiaming' '�- " A� -� _ r= 71. Undergr'n'd. S[a',a��'an� O Gas [�"Oil 25. Roo.LSheaxh�ng - _ `�_�� u,f/p ` 73�:=0verhead Hydrd t �� 26. ��8'ar Ceilin 4Structural) & fJl ocoat ` r .r ` " : '� _ �r 9 , Qh _ }. .� .,, -, � 75.,bry Chemi.pal F,.� �. ;., 27. F,rame and Flashiygt ;- s• i r r R 76. �Dry Stasc2ipipe- � v� � J < .�,_ 28. Lathing & Siiiin9 _ ` ' _ ^ y �� 'E "� "� '��k �7�. FIXEQ�%�T��R FINqL� � � 29. Insulation �• tii �� - � r . �r Z8. FIRE PREV. FINAL • - 'T• '� ' 30. Orywall t�ailing '-' V � � � �F '� �Fi�ALTIi DEprY:'FiEQUIB.EMENT R• , 31. Plaster0rown�Coat. � �-r e � � r: 7��, FINALtDJSPECTifON �� • ti_ � 32.:Electrical Po�er hAe�er.Fi�al � �'U �� 8l� FOOD CERTIF�JC�FlTE fr5$UED � • 33. •Findlj Electri�. „ r: ^ t � i � 'S � Notes �y �;r, �� ) i �] ,. I ;;: �: S ~'.L • 5 7" ; 34.'FinaLHeatinq"& Ait•Conditio�i�l�_. ' � - ' r �� k � � t •n, 35. finafGa;.Pipg:Test; - :. � � I 1 ��: _ ' ;.�.; �,� � �„ �-i i �. - - ' 36. Hood or:CanoPY F : - = • '� � � 1'r :. E � � � • � ' T' . � r -- � t 7 � � 37. ina Facmr Fire �ace : ; �� f.' 1: v a. -_ j I�. a r , 38. Final,Plumbing � . �� . ka �: � •: •a � "-- � � k �-� .�<, j -7 � 39. Wate7 Se�vicecFinal; � " K � �Y' ' ,� �' S - i 40. Gas Service-F�nal � r��: t-i � � �� :+'� t� � � I � � 41. Solar pomestic-Fin�l • � •' ::'} � '� ~ ` ' �� z �t �s' 7 N '� � 42. Backflow Preventer. n ; �e r. �- • e•7 � "1' V f - �43. Backflow Irr�gation; � `-• = ` " ' lp�Z��p�=T� �/ �r� ��„ _Q, , . - K :C � � � =( �. ,N[.LC.�./ ✓ A � '/ 44. Landscape I�(ipation System� �� j � ,r, i = � � . �r ��; -� ' � � •v � � - � s• � �1 r �� 45. �Sound Attenuation' � ' ° " " ' ` � �' �'� �'= : , �r . . r r r, �:7 x • 46. Handicap.Regulatiods - � i �� a ; _ ?'� S � � 47. EINAL STROCTURE & BUILDING ` �"'1� � = ' _ ; _ � O i �: 48. PINAL PLANNINGs -� - > U � � 'x •i _ � �' . �19. Electtic Ralease to Edison � ` �� ! � ' � r • � �, ' .. .. , c . � � _ 50. Gas Release to Southem California Gas Co � , (;: " .a ? • � �! . � • . - i - a - _ 51. CERTIfICATE OF OCCUPA�NCY � . , r � - , � No. Dace �