The URL can be used to link to this page

Home My WebLink About379 21ST ST - Building Permits1) APN: County: Census: Map Pg: New Pg: Phone: Owner: Mail: Property: , 426-232-28 ORANGE,CA �BJECT PROPERTY INFORMATIC � COSTA MESA CA 92626 NEWPORT HEIGHTS TWO Tax Rate Area: Prop Tax: Delinq Tax Yr: Exemptions: 1501 WESTCLIFF DR #260; NEWPORT BEACH CA 92660 SALES INFORMATION LAST SALE Transfer Date: 10/0'1197 Sale Price/Type: $500,000 F�ULL Document #: 488798 Document Type: GRANT DEED 1st TD/Type: Finance: Junior TD's: Lender: Seller: BEACH GUS & LUCILE TRUST Title Company: SOUTHLAND TITLE CO. Transfer Info: SITE INFORMATION Improve Type: Zoning: County Use: Bldg Class: Flood Panel: Phys Chars: Legal Comments: PRIOR SALE Lot Size: Lot Area: Parking: Park Spaces: Site Influence: Use: Total Value: Land Value: Imprv Value: Assd Yr: 1997 % Improved: IMPROVEMENTS Bldg/Liv Area: # Units: # Bldgs: # Stories: $/SF: YrbIUEff: Total Rms: Bedrms: Baths(F/H): Fireplace: Pool: Bsmt Area: Construct: Flooring: Air Cond: Heat Type: Quality: Condition: Style: Other Rooms: Copyright O 1996-97 Experian Page: 1 of 1 , (714) 754-5273 • Fan (774) 754-4856 • www.ci.costa-mesa.ca.us 77 FAIR DRIVE, COSTA MESA, CA 92626 BUILDING PERMIT Job Address: 379 21 ST ST Suite: Vicinity: 2ND STORY Parcel Number: 42623228 Applicant: LOWE, ROBERT Address: Owner: SWIFT, JACK & DEBBIE Address 37921STSTREET � COSTA MESA, CA Zoning: Phone: 949-650-0527 Zip: Convactor: KELLER AND LOWE BUILDERS Address: 723 OHMS WY COSTA MESA, CA Zip: 92627 Phone: Zip: 92627 Phone: 949-650-0527 License: 793705 Status: ISSUED Applied: 07/29/2002 Issued: 12/30/2002 Arch : ,. Eng: BROADY STRUCTURAL ENGINEERING Address: Address: 27001 LA PAZ RD - � Phone: STE 430 8 Phone: 949-583-0620 � � MISSION VIEJO, CA � Zip: - � License: 92691 License: SE3016 SCOPE OF PERMIT- ,- ADD 198 S.F. RECREATION ROOM TO EXISTING 2ND STORY. REMODEL EXISTING LAUNDRY ROOM. NO CHANGE IN SETBACKS OR COVERAGE. 2ND STORY EXPANSION WITHIN EXISTING 2-STORY STRUCTURE ONLY. ; Plan Check: Permit: , SMIP Res: ' SMIP Com: Other. ; Inspection: Total: $418.76 $644.25 $5.00 $0.00 $0.00 $0.00 $1,068.01 SETBACKS MAINSTRUCTURE Front 0-0 ACCESSORY Front 0- 0 PARKING Existinq: 0 Rear 0- 0 Rear 0- 0 Re uired: 0 FEE SUMMARY Calc Valuation: Sso,000:oo Claim Valuation: S5o,000.00 PLANNING 8 ZONING Left 0- 0 - Right Left 0- 0 Right Propased; 0 � o- o �i NOTICE: The work authorized by this permit shall comply with all applicable handicap access requiremeMs under California statutes and related �� regulations. (Ord. No. 92-28, § 1, 12-21-92) EXPIRATION: This permit shall automatically expire and become void if work is not commenced within 780 days, or iF work is suspended or abandoned for a pe�iod of 1 BO days. INSPECTIONS: In order tor ihe work authorized under ihis permit to be considered legal, such work must comply with all applicable codes, a all requlred inepeetions and final approval must be obtained. Failure to obtain inspections and final approval will result in the axpiration of this p� it. FOR INSPECTIONS CALL: (714) 7545626 zaau-an ��uu� WORKERS'COMPENSAnON DECLARATION: � ' I hereby eHirm untler penelty of per�ury one of Ihe following declaratlons: ❑ I heve end Will melntaln e certificate of consent to self-Insure for workers' compensatlon, as proviEetl lor by section 3700 af the Lebor Code, for Ihe pertormance of the work for whiCh Ihis pertnit is issuetl. � I have and will mai�ntain workers' compensation Insurence, es requlred by secllon 3700 ot ihe Lebor Code, for t�e pedortnance of the work for which this permit is issued. My workers'�ro mpeos,e�tlon Ins nce carder entl policy number ere: Cerrier:% �SvF7� 't+'�S1 Pa��yflumbeF�• % l0 Z��f Z-Z`�''/ �(7his secfion need not be crompletetl il fhe permit Is ve/ued et ne huntlred dollers ($ f00) or /ess.) ❑ I certity that in the peAortnance ot the wo�k for whic is permit Is luued, I s�ell not employ any person in eny manner so as to become sublect to the workars' compensatlon lews ol Celifomie, en �ee thet I houltl become sub�ect to the workers' compensetlon provislons ot Sectlon 3700 of Iha bor Cade, I shall torthwith comply with lhese provisions. AppllcanbSign�— ' lDete?� ) 2jT� � "L WARNINO: FAILURE TO SECUR ORKERS' COMPENSATION COVERA E IS UNUWFUL rWD SHALL SUBIECf AN EMPLOVER TO CRIMINAL PENALTIES AND CIVIL FlNES UP TOONE HUNORED THOUSANO Dd1AqE (5100,000�, IN ADDRION TO THE WST OF COMPENSATION, DAMAGES PS PROVIUED FOR IN SECfION 3108OF iHE 1A80R CODE, IMEFEST, AND AiTORNEI^5 FEES. LICENSED CONYAAC70RS DECLAiiA710N: I herebv eNirm ihat I am licensed under omvisic Sec�lon 7000) ot Division 3 o�f ��he Business and Protessions Code, and my license is in full _ �Gess'M` — CDa�e:� /Z J J Z CONSTRUL710N �ENDING AGENCV: ❑ I hereDy aRiAn that Ihere is a construction lendlnp egency for ihe peAortnance of the work tor which this permit is iuuetl. (Sec. 3097, Civil Code). Lentlers Neme: Lenders Atldress: SiqnaWre: Date: OWNER-BUILDEP DECLARATONS: I here6y ettirtn tha� untlar penalry of perjury �het I em EXEMPT FROM 7HE CONTRACTORS LICENSE LAW for ihe tollowing reeson (Sec. 7031.5, Busineu flntl Professions Code: Any ciry or counry which requires e pertnit to construc6 elter, Improve, demolish, or repair eny siructure. Prior to its issuance, elso requires the applicant for 5uch permit to file e signetl steiement ihat he or she is licensetl pursuent to the proNslons of Ihe Contractors License Lew (C�epter 9(commencinq with Sectlan 7000) ol DiWsion 3 of ihe Business and Professions Code) or that he or she is ezempt therelmm antl Ihe basis lor the alleged exemption. Any violation ol Section 7031.5 6y eny aOPlicant for e pertnit subjects t�e epplicent to e civil panelry of not more then Ilve hundretl dollars (3500).): ❑ I, es owner Of the pmperry, or my employees wlih weges es thelr sole compensatlon, WILL DO 7HE WORK, enA Ihe siructure fs not intended or otteretl for sa�e (Sec. 7044, Busin�ss end Pmfessions Cotle: The Contractore License Lew tloes not appty to en owner ot properry who builtls or impmves theraon, antl who does such work himseli or herseli or through his or her own employees, provided ihet such improvemems ere not Intentletl or oHeretl tor sale. tl, however, Ne 6uiltling or improvement is soltl within o�e year ol compietion, the owner-builtler will heve t�e burAen of praving that ha or she Altl not build or improve br purpose of sale.). - ❑ I, as owner a� Ihe Droperty, em E%CLUSIVELV CONTRACTING WITH LICENSED CONTRACTORS to construct the projecl (SeC. 7044, Business and Prolessions Cotle: The conirectors Licensa Lew tlaes not epply lo en owner ol pmpeny who hullds or Improves �hereon, end who contracts for such proiect with a coniractor(s) license pursVant to the Contractors License Lews.). � ❑ I em exempt under sec. Business end Prolessions Code for Ihis reason: Signature: Date: � Owner ID verified py drivers Ilcense. ❑ Ves � No DriveYs License No. Expires: Venfication ot Ownership by (type oi tlaumem, i.e. - properry taz 6111 or tleed): DIVISION OF INDUSTRIAL SAFETY PERMIT CERTIFIGATION: � ❑ I hereby certlly that no excevetion fiva (5) or more leat in depth Into which e person Is requlretl to tlescend, wlll be matle In connection with work authonzetl by Ihis permit, end that no bullding strucNre, scaflolding, lalsework, or demolition or dismentling ihereof, will be more ihan thirty-six (36) feet high. (Chap. 32, Grp 2, Art 2, Sec. 341, Tltle B, Galifarnle Atlministretive Cotle). ❑ As owner-builder, I will not employ enyone to do work which would require e permi� from the Division ol Industnel Safery, es notetl above, unless such person has e permit ta do 9uch work irom the tlivision. Signature: Division ot Industrial Selery Permit Numbar: Date: Will the epplicant or present or tuWre 6ulltling occupant need to flle antl certity e Business Plan for emergency response to release or threatened release ot e hazardous metedel7 ❑ Yes ❑ No (Section 25505 ot the Celitomia Heelth and Sefery Cotle requires, with some ezceptions, that a Business Plan be filed with tha Costa Mesa Fire Depanment by svery business which hes et any one tima tlunng e reported year e quanliry of hazartlous materials aqual to or greator then a waigM of 500 pounds, or a volume oi 55 q311ons, or 200 cubic foet of compressad gas at stantlartl temperature entl pressure). ......................................................................................................................................................................................................................................................................................... ....................... ................................................... Does or will Ihe applicant or present ar future building occupent need to file a registretion form for ecutely hazerdous matenals? � Yes ❑ No (Section 25533 of the Calilomia Heallh end Sefery Cotle, wilh some exce tlons, requlres reglslreNon with the Casta Masa Fire Departmeni by each business whic� at any one time has on hand e quantiry ot acutey �ezardous meterials equaPto or greater then e welght oi 500 pounds, or a volume of 55 gallons, or 200 cubic feet of wmpressetl gas at stendartl tempereNre end pressure). ........................................................................................................................................................................................................................... ............................................................. ............................................................ ...................... Does or will Ihe epplicant or presem or luture DuilCing occupant need to prepere an RMPP (Risk Managemeni end Prevention Program tor acutely hazardous matenals)7 ❑ Yes ❑ No (Section 2553�1 oi the Cellfomia Health end Safary Code provides �hal ihe Coste Mesa Fire Department may require the preparation, certification and filing wlth ihe Fire Deoartment af an fiMPP by businesses w�ich ere required to repister ecutely hezerdous materlels witn the Fire Department. u an HrnYr is Prasemry reqmrea, nes senion zosso rn me camomie neenn ena �erery c;otle been ruiry compue ............._..............,..._..............................._.__.............................................._..............................__.................................._..............................._....... Does or will t�e eppllCani or presen� or future building occupant requlre for Ihe work which is the aub�ect ol Ihls Irom Ihe Soutp Coast Alr Oueliry Manegomen� Dis�dc� or from eny othar air pollu�lon coNrol distdct or egency7 (Section 65B50.2 a� tho Calilornia Govemment Code raquires thet tha requestetl Intormation ba furnishetl on ep{ .............................................................................................................................................................................................................._........................ Will eny peR o<<he feciliry Ia be canslrutted under Ihis pertnit be wlthin 10001aet from the outer boundaries of e llt yes", ihe ia��ty must maet ihe requirement ot Sections 25534 entl A2303 of �he Calltomie Heaith end Safery tor noo-residential ................__............................................................................_.............................."'............................�_.........................................................................__ Ihe South Coast Air OuelitY Menagemant Distdct or other air pollution conlml district ar egency is requireA for the � ell of the tlisclosuras orescrihetl bv Celifornie Health end SefaN Code Sectlon 42303 �een metle? ❑ Ves ❑ No or CER7IFICATE OF COMPLIANCE: I ceniy that under penalry of perjury the information qiven ebove is wrrect. I agree to comply with all state laws antl ciry o�Cinances regerding Harardous Materials an0 Emissions. Signature: Date: CER71FlCA7E OF COMPLIANCE AND AUfH IZA710N OP EHTRV: I cenify under penalry of perjury ihat I have reatl this application and state ihat the information given is wrrect. I agree to �pty wlth all state la e� city ordinances releling to buildi`g construction, erW euttwrize repcesentatives ol t�e Ciry ot Costa Mesa to anter upon the ebove-descnbed ploperty lor inspection es. I egree not to occupy or allow occupanq oi eny builtling authorized by this parmit until Tinal inspection. CQOE �. �ySQEGLQH7�QE 1616 Fixed Syslem Final Fire Preventlon 1266 Pool Spa Final 200 Finel Re-F�� 207 Final BIaWRetelning Well 202 Final FeCIPry Fire Plece 203 204 Finel Sign Finel Demolition Owner(s) ApPlicant - - � _ DATE IIRID9La COOE I INSPELTIONTYYE 206 Final Mec�anital 208 210 212 220 222 250 Final Plumbing Finel Elec�rical Finel Fire Prevention Final Planning Appmval Final Site Final Buildin<yOccupancy Pdg I[�LS , (714) 754-5273 • Fax (714) 754-4856 • www.ci.costa-mesa.ca.us 77 FAIR DRIVE, COSTA MESA, CA 92626 ELECTRICAL PERMIT Job Address: Suite No Vicinity: Parcel Nunmber: Applicant: Address: 379 21ST ST 42623246 LOWE,ROBERT 723 OHMS WY COSTA MESA, CA Phone: 949-650-0527 Zip: 92627 Owner: BEACHCLIFF IN COSTA MESA HOA Address %NEWPORTHEIGHTSTWO , NEWPORT BEACH, CA Phone: 1501 WESTCLIFF STE 260 Zip: 92660-5513 Contractor: Address: ISSUE FEE Temp service test Res. alc package New Res (1-2 units) New Res (3+units) Pool / Spa Lighting FixLs Recept Outlets Switches � Non Res Appl Res Appl � .. Service to 200a �� Service to 1000a Service over 1000a Motors to 1hp Motors to 10hp Motors to SOhp Motors to 100hp Motors over 100hp Communicalion drops Sub panel to 200a Pole Light Pkg KELLER AND LOWE BUILDERS 723 OHMS WY . COSTA MESA, CA � Phone: 94&650-0527 Zip: 92627 License: 793705 ISSUED BY: Status: ISSUED Applied: 12/30/2002 Issued: 12/30/2002 SCOPE OF PERMIT ELECTRICAL TO INCLUDE: 4 LIGHTING FIXTURES, 7 OUTLETS AND 1 SWITCH LOCATED IN THE RECREATION ROOM. REF.: B02-01178 . "" " - " � - � 523.50 $0.00 $0.00 $0.00 $0.00 $0.00 $4.40 $7.70 $1.10 $0.00 $o.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 $0.00 Quantity FEE SUMMARY Temp Dist System / Lighting Busway/100 N Standing Section Misc Electrical Equipment � -" ?ransformers up l0 1 kva/kw `: � ...............:up to 10 kva/kw .................up to 50 kva/kw .................up l0 100 kva/kw �. . ..................over 100 kva/kw � Low Voltage Equipment Low Volt Wiring System / Ckt Misa Conduit Misc. Conductar Circus ( gen or ride) Circus (mech ride or lights) Chnstmas Tree Sfand Fireworks Stand Other Electrical Fee Investigation Fee Plan Check Fee Reinspection Fee Quantity $0.00 0 $0.00 0 $0.00 0 $0.00 0 $0.00 <A $0.00 0 $0.00 ' 0 $0.00 0 $0.00 0 $0.00 0 so.00 0 $0.00 0 50.00 0 $0.00 0 $0.00 0 $0.00 0 $0.00 0 $0.00 $0.00 $0.00 $0.00 NOTICE: The work authorized by this permit shall comply with all applicable handicap access requirements under California statutes and related iegulations. (Ord. No. 92-28, § 1, 12-21-92) EXPIRATION: This permit shall automatically expire and become void if work is not commenced within 180 days, or if work is suspended or abandoned for a period of 180 days. . INSPECTIONS: In order for the work authorized under this permit to be considered legal, such work must comply with all applicable cotles, and,all-I requlred Inspections and final epproval must be obtained. Failure to obtain inspections and final approval will result in the expiration of this permit! FOR INSPECTIONS CALL: (774) 7545626 � 3.l•�:Yf•:L:)] WORKERS' COMPENSATION DECLARATION: � I here6y aNirm under penelty oi perjury one of the tollowing declarations: ❑ I heve entl will meintain P certificate of consent to self-Insure for workers' compensatlon, as provitleA for by section 3700 ot the Labor Code, for the pertortnance ot the work lor which lNs perml� is is5uetl. �I have antl will malntein Workers' compensation insurance, as requiretl by sectlon 3700 ot Ne Le6or Coda, for the peAortnance of Ne work for which Nis pertnit is issued. My wo rs' compans�tlo Insurence wrner end policy number ere: Carnec .�7�77G NA Policy Number. IG Z Vy9 L' Z�� (lhis secflon need not be comp�efed il tne permit is velued et one huntlre0 dollars ($100) or /ess.) ❑ I certiy Ihat in t�e pertormence ot t�e work for which this permit Is Issued, I shall not employ any person in eny manner sa es to bemme subject to the workers' compensatlon laws oi Califomia, entl egree that It I shoultl become subiect to t�e workers' compensetion proWsions oi Sectlon 3700 ot t�e Lebor Code. I shall forthwith comply wiM Ihese provisions. ApplicaNSigneWre: � Dete: WARNINO: FAILURE TO SECURE WORKERS' COIdPENSAiION COVEFAGE IS UMAWFUL AND SMFLL SUBJECT AN EMPLOYER TO CRIMINPL PENALTIES AfJD CM� FlNES UP TO ONE HUNDRED TFN%1SMlD OOILARE (5100,000�, IN �DfTION TO THE WST OF COIAPENSATION, OAMAGES AS PROVIDED FIXi IN SELTON 3]OB OF THE LABOR CODE. IMEREST, PNO AiTORNE`fS FEES. LICENSED CONTRACTORS PECLARATION: I hereDy eNirm Ihat 1 am licensetl untler provisi< force end eMect. Lic. q ✓'� � Contrectofs Signawre:� (commencing with Section 7000) of Division 3 of the Business entl Professions Cotle, and my license is in full Class q � Dete: /2 'S� JZ CONSTRUCTION LENDING AGENCY: � I hereby aHirtn thet t�ere is e construction lending egency for the pedormance of t�e work for whic� ihis permit is issued. (Sea 3097, Civil Cotle). LendeTs Neme: LendePs Atltlress: Signature: Date: OWNER-BUILDER DECLARATIONS: I hereby eHirtn t�et untler pena�ry of per�ury that I em EXEMP7 FROM THE CON7RACTORS LICENSE LAW for ihe tollowing reason (Sec. 7031.5, Business entl Profeuions Cotle: Any ciry or counry whlch requires e permit to consimct, alter, improva, demolish, or repair eny strucWre, pnor to its issuance, elso requires Ihe applicant for such pertnit to file e signed stetament Ihat ne or she Is licensetl pursuent to ihe praNslons of ihe Contracbrs Llcense Lew (Chepter 8(commencing with Sectlon 7000) of Divlsion 3 of the Business end Professlons Code) or thet he or she is exempt therefrom end the 6esis for the alleped exemption. Any violation ot Sectlon 7031.5 by eny applicant for e permit suhjects tha applicant to e clvil penalry of not more than five hundred tlollars (5500)J: ❑ I, es owner ot the property, or my employees with wages as their sole wmpensallon, WILL DO THE WORK, end the structure is noi in�entle0 or oHeretl for sale (Sec. 7044, Business end Prof6551ons Code: The Con�rectors Licrense Law dces not epply Io an owner of property who builds or improves thereon, and who does such work himseli a herself or ihroU9h his ar har own employees, pradded t�at such impravemenis ere not Intentletl or oflered tor sale. Ii, hawever, the building ar improvement is sold within one year of completion, the owner-�uilder will have the 6urden of proving that he or ahe did not huild or improve for purpose ot sele.). � ❑ I, as owner ol ihe property. am E%CLUSIVELV CONTRACTING WITH LICENSED CONTRACTORS to construct the pro�ect (Sec. 7044, Business and Prolessions Code: The wniractars UGense Law tlaes not apply ta an awner ot proparty who builAs or tmDrovas thereon, entl who contracts tor suc� p�o{ect with a contractw(s) license pursuant to the Co�lrectors License Lews.). ❑ I am axempt under sec. Business and Pmfessions Cotla tor this reeson: Signeture: Date: Owner ID verifietl by Crivers Ilcense. ❑ Yes ❑ No Drivefs License No. Venficatlon of Ownership by (rype oi documen6 I.e. - property taz �ill or deed): DIVISION OF INDUSTRIAL SPFETY PERMIT CERTIFICATION: Eapires: ❑ I hereby certity thal no extava�ion five (5) or more feet in depth into which a person Is required Io descenG, wlll be mede in connection with work authorized by this permit, antl Ihat no building strucwre, scattolding, lelsework, or tlemolition or tlismantling thereof, will be more than thirty-sl: (36) teet high. (Chap. 32, Grp 2, Art 2, Sec. 341, T1tle B, California Adm�nistretive Code). ❑ As owner-builder, I will not employ enyone to do work which would require e permit from the Division ol Indusiriel Sefery, es noted above, unless such person has e permit to tlo such work irom Ihe tlivislon. SignaWre: Date: Division of Industrial Safery Permit Number: CERTIFlCATE OF COMPLIANCE AND AIJTHORIZATION OF EMRY: I certify under penalry ol perjury that I have read this epplication end state ihet Ihe information given is correct I agree to comply wilh ell siate la end ciry ordinences retating to builtling consWction, entl eut�onze representatives of tha Ciry of Coste Mesa to enter upon the ebove-described property for in5pectio rposes. 1 agree not to occupy or allow occupency of eny building authodzed by Ihis Dermit until final inspection. ' net� e Of el Owner(s) ate l7i/%� OZ And�Or Authonzetl Applicant Date COUE I. INSPECTIONTYPE 167fi FIaeC System Final Fire Preventlon 1266 Pool Spa Finel 200 Final Re-Root 201 Final Block/Retaining Well 202 Final Fectory Fire Place 203 Final Sign 204 Final Demolition OpTE INTRIRLS COOE� INSPECTIONTYPE 206 Finel Mechanical 20B Final PlumDinp 210 Final Elecincal 212 Final Fire Prevention 220 Final Planning Approval 222 250 Final Site Final Builtling/Occupancy PAIE 1[�9Lfl . ■■■� Hall & Foreman, Inc. ■■ �. Civil Engineering � Planning • Surveying • Public Wort:s October 9, 1997 Department of Building & Safety City of Costa Mesa 77 Fair Drive Costa Mesa, CA 92626 Re: Tract 15468 Lots 1 thru 6 Gentlemen: � Job # 4816 Please be advised that we have field surveyed the rough grading for the above referenced lots and have found the building pad elevations to be in substantial conformance to the approved grading plans. Warner Younis, P. No.37445 Exp.6/30/:� O 203 Notlh Golden Circle Orive, Suile 300 Santa Ana. California 92705-4010 Tel 714/fi64-0570 Fax 714l664-0596 , , � ' NorCal Engineering Soils and Geotechnical Consultants 10641 Humbolt Street Los Alamitos, CA 90720 (562)799-9469 Fax(562)799-9459 October 2, 1997 La Quinta Homes 1501 Westcliff Drive, Suite 260 Newport Beach, California Attn: Mr. Mark Cernich Project Number 6685-97 RE: Observation and Testing of Rough Grading Operations - Proposed Residential Development - Located at 379 21st Street, in the City of Costa Mesa, California Dear Mr. Cernich: Pursuant to your request, this firm has, observed and tested rough grading operations at the above referenced site. The results of the compaction tests are attached and locations of these tests are shown on the accompanying Site Plan. All work was performed in accordance with our Geotechnical Investigation dated April 21, 1997, Project Number 6685-97, and all present day standards of the Geotechnical Engineering Industry. - :• �• All vegetation and demolition debris was stripped and removed from the fill area prior to grading operations. The existing low density soils were removed to competent native soils, the exposed subgrade scarified, moisture conditioned and then recompacted to a minimum of 90% relative compaction. All excavations were observed and approved by this firm prior to placement of fill material. The oversxcavation consisted of a minimum of five horizontal feet or to the depth of fill placed, whichever is greater, beyond the outside edge of all proposed foundations, where possible. P October 2, 1997 Page 2 J Project Number 6685-97 Two cesspools were located in Lot #2. These areas were excavated to depths that allowed for the placement of an 8' thick compacted fill blanket after the cesspools were hydro-consolidated as recommended by this firm. Fill soils placed were compacted to a minimum of 90% of the laboratory standard in lifts not in excess of eight inches in thickness. The maximum depth of fill placed was 8 feet. A rubber tire loader was utilized for compaction control. A water hose provided moisture control. The approximate limits of compacted fill are indicated on the attached Site Plan. l,aboratory/Field 7estina ' The relative compaction was determined by Sand Cone Method (ASTM: D1556- 82) and by the Drive Tube Method (ASTM: D2937). The maximum density of the fill soils was obtained by the laboratory standard (ASTM: D1557-78) and results are shown on Tabfe I. Tests were performed a minimum of every 500 cubic yards placed and every two feet in depth of fill placed. Results of field density tests are presented in Table II. Foundation Desiqn The foundations may be designed utilizing safe bearing capacity of 2,200 psf for an embedded depth of 18 inches below lowest adjacent grade into approved compacted fill soils or competent native soils. A representative of this firm shall inspect all foundation excavations prior to pouring concrete. Slab Recommendations All concrete slabs-on-grade shall be a minimum of four inches in thickness and may be placed on approved compacted fill soils. A vapor barrier should be utilized in areas which would be sensitive to the infiltration of moisture. This membrane should be placed beneath a 2 inch thick sand layer and not directly beneath the concrete due to the possibility of curling of the slab. NorCal Engineering � . October 2, 1997 R.,ject Number 6685-97 Page 3 All concrete slab areas to receive floor coverings should be moisture tested to meet all manufacturer requirements prior to placement. �onclusions 7he geotechnical engineering aspects of the grading have been observed and are in compliance with the geotechnical engineer's recommendations. The development has been graded to the approval of this firm and is suitable for its intended use. We appreciate this opportunity to be of service to you. If you have any further questions, please do not hesitate to contact the undersigned. 12espectfully submitted, NORCAL ENGlNEERING ��, �.-� � �J Keith D. Tucker � Project Engineer � I R.G.E.841 �' No. 841 Exp. 12/31 /00 �� `�v�-C, ��t'-� � � � Mark Burkholder n:� a� Project Manager NorCal Engineering October 2, 1997 Page 4 .u•- �� Project Number 6685-97 TABLEI MAXIMUM DENSITY TESTS IASTM: D1557-781 Optimum Classification Moisture SAND, fine to 10.0 medium grained, slightly silty SAND, fine to medium grained, with brick III SAND, medium to coarse grained, slightly clayey with occasional gravel IV SAND, fine to medium grained, slightly silty � 7.5 E:� NorCal Engineering Maximum Dry Densi�(Ibs./cu.ft.) 125.0 128.0 131.0 125.0 a October 2, 1997 Page 5 i� 1 .._J Project Number 6685-97 TABLEII COMPACTION TEST RESULTS Date of Test Percent Unit Wt. Relative I�t �L2, 'De t�h Moisture Ibs•/cu'ft' Com action 9/ 17/97 101 4. 5-5. 0 11.0 115.1 92 9/17/97 102 3.0-3.5 14.5 110.0 88 9/18/97 102A" 3.0-3.5 10.7 114.3 91 9/17/97 103 4.0-4.5 9.1 114.1 91 9/18/97 9/18/97 9/18/97 9/18/97 104 105 106 107 4.0-4.5 3.0-3.5 3.0-3.5 3.0-3.5 9/18/97 108 1.0-1.5 9/18/97 109 6.0-6.5 9/18/97 110 4.0-4.5 9/18/97 110A`* 4.0-4.5 9/18/97 9/19/97 9/19/97 9/22/97 111 112 113 114 3.0-3.5 0.5-1.0 2.0-2.5 6.0-6.5 10.0 10.3 11.6 9.8 9.4 9.1 10.7 9.9 9.6 9.1 7.9 10.7 114.3 115.4 113.5 112.6 114.0 116.4 110.7 115.1 116.2 117.5 119.6 116.8 'Depth below finish grade (in feet) '*Retest of failing tests after area reworked NorCai Engineering 91 92 91 90 91 93 89 92 93 94 91 93 October 2, 1997 Page 6 Date of Test I�t Ly4.. g/22/97 115 9/22/97 116 9/22/97 117 9/22/97 118 Project Number 6685-97 TABLEII COMPACTION TEST RESULTS Percent Unit Wt. Relative Soil 'De�th Moisture Ibs /cu•ft• Com a� Iy9� 4.0-4.5 9.0 118.9 93 II 1.5-2.0 9.7 119.5 93 II 0.5-1.0 9.1 117.6 92 II 0.5-1.0 11.5 115.7 93 I 9/22/97 119 0.0-0.5 9/30/97 119A" 0.0-0.5 9/22/97 120 0.0-0.5 9/30/97 120A'" 0.0-0.5 9/24/97 9/24/97 9/24/97 9/24/97 9/30/97 9/30/97 121 122 123 124 125 126 3.0-3.5 2.0-2.5 1.0-1.5 0.5-1.0 0.0-0.5 0.0-0.5 15.1 11.1 9.9 7.8 9.1 9.5 9.3 9.7 .� 0 110.0 117.9 113.6 121.7 115.6 117.1 116.6 117.5 'Depth below finish grade (in feet) "Retest of failing tests after area reworked NorCal Engineering 92 94 93 94 93 93 IV IV IV IV IV I I CErSPoot-S ��'+ev50ln ' 8' 8610 W F'00T/NGS UroiTS 6F GRRD/N6 �-- ---------�---------- ----� � �or !i9 lii � W I io� � I lox . �oY 117 r_ us � � I{I '�lo � � ii� I � �� i19 Ilf. � _ _ ios iob �o� �:� � I roe �i� iu "�` I �---------------------- - Z---- «r � NorCal Engineering SOILS AND GEOTECHNICAL CONSULTANTS LA pu�nirA PROJECT 6695-97 OpTE OGT. i997 �= Uepth of Fill ��. �«_� LOCATION OF COMPACTION TESTS � �� -........�r.'=�q ^�"'z+i'l.��.J�.^^'�.�..•e'^.—r+tti.n,;,;tv�.�tir.�.+iv�^✓`7;n...a+•l^:-rV-.n.^....y--�u. �� . , ' � ; . .i • ( ,� r. � .c « � ...� . '{t � N•R • L � ENGINEERING � � o SOIIS AIVD GEOTECHNICAL CONSULTANTS Field Observation Memo 10641 HUMBOLT STREF_T 1_OS A7_AMITOS, CAllPORNIA 90720 PFIONL- 562799.9469 • I'AX 562.799.9459 Project G� �lv�„�� ,�5 Date /O//�///r � Address ��7 ,,�, 3 g 7 y/s� �� Project Number GG5fi7 , -- , �Ui/�? `n.�s�9 �s�-Cc�edC ,� l�rJ.Jysi�lOvS �rJ7��,S' -�L � i _. . , f.r /� i i / �, _ / / Accepted by NorCal Representative �� r..�n!I..kH�lliw;� ,r W �vf'S ' �# •. � � � . . . . L. a j ��.`. . � � � . �� ` l�i OO F�2 C� l� ��ENGINEERING � . '"�'°�'&�i sa -,�e ^��.�. s-+�y`n l�, � SOILS AN� GEOTECHNICAL CONSULTANTS � :� m Field Observation Memo° -' � . �o6q� HUM60LT STREET LOS ALAMITOS, CALIFORNIA qo7zo PHONE 3�0.�99.94G9 - FAX 3�0.799-9459 Project L� G",,,>,d Date 9�i�/s � Address �,�2c�, a/ � . . �.�5� ,� /%Nri9 Number ii�r-. . `w�'y`� � : • ,.. 'a.' . . ' , -'a4 .. . � lh T.uh i A-7ii .8 L �t s�1i �"�t;" .r` >ifi i?'�if.a�'; .G•. / � p /� / '� i!;�i�ir�i�/�...�r _Gb�>r..n _',.��.o�i�a-�r .Gw /rsr .'�'tl ,.. - ��./a�/ ��!>Ac�i /J ��.-.r .s/i�iz�.� A./r�i�v �! Jrii- . , . .i ' �.z�:,W'§.`�ii' � R-%i.1i1 i7 A/� .��r � i �i� �C . .. i, . � .��/ ,l'IlJ�' � �� .0� // d /rt� . �y .� r.�/%✓ �Gf�C/7' �si /`.. � �/iC� /�/fifi Q'�C� /n.// /�.4If'/ �.4� ti�ia/ �'-+. � �� ,il ,.- O �>% i�/ .n ; y% --- �"" NorCal Representative ��„m� V:' .,�/ ; �� -c. , , ; "C ��SOILS/. ir . � 1- '*�' i . - " -. �`'4 -, . � ;F.'_~. �l..�i:.- '��3. � .--s.;1 �.�Y .. t . ��.�., . _ .�.- t'.J.r , � + � •;s� a �• '� "_c':" _.+� '-i' ' . _ • ' , � ' . , F �v ! ' � . . .. S i :i �": 1 ':. ... i:� '.. ' . : .. '" . 'r � '+ ' ' ' .,' � `� Field Observation Memo� t�1 �O R �C A L. � ' - �.. � . - ' �NGIN�EE�RINC.�� '�"� ' , ; , ' �. � �,� �I.��'-„ �o6�j� HUM60LT STRLGT � � ;1�,^� � ' LOS ALAMI"I'O5. CALIFORNIA 9ojzo I *G:EOTECHNICALCONSULTANTS . PHONE 3�0.799=9A69 - FAX 3��-799-9459 � . ' , � i'��✓ l:. ' . . �< � r . 1'....' ri � �, .�. � . . . . .. ��f`';y��.�� ' �: :. . ' . .,, ., � . ` ; . !, . ." ' , . � i . � • � ... y ' . . . `1 , .. 1 � . ,. ' � ' . . � ' . �' ..�-' \ � . . , ., �Project "�'`�*Gi �„ " .i Date q��_/y7 -Address '`i•�Zg� •�/_' S9 � Project Number /pp„S -^7' � � � �// _ �'� � � � � ,. ' �-�(,GS7F �NS/f �I • � _ . . . �� , r ... ....' - �,� , " . ' . . ' . -- � ' , ' � . -� . , - - • ... , /' ,-•' � a �i i � �, A.✓O �i�" t>�-o �r Ba i.�/ �..iir.0 /.�.9 /Jrr r �� ' i - • i _ -. " = �.✓�,vh . s�.a.��f> t.srz.�vs- �'a"1 � .csv.�a- : c�',�-/� 9c / � _�i _ �_ , ° ; ; v, ' , '%IY�it➢�!✓u�^ .'t'�ci,��A��icn/ ` ifl.�./J TiM✓ A-�P-.w�ls .iSif9t/e-` �iiw- �� C- ' ! . ,..n . , ./JIe/s'9GAir �v�i�r. � A�// -1vAiiv�N s�4if�zr T�r-// RF-�. ' '"� . �OA-/�9'.v/1 -:�i. �.4-^�t //�'A'f,' /�'J� l.✓/9�lJ if-✓rA/R C.091/Y�tA7 � . �.7'J�ir �c,�P.�-� �us�i Accepted by . ' � :_ / ,•,� , , * �J� � ; '� _ . 1�.. _ . .. _ _. s �,�z 1�1 sO��, R�C��A��L��, � ENGINE�RIIYG � e� 4�4 z SOILS ANf� GEOTECHNICAL CONSULTANTS Field Observation Memo � �oGq� HUMBOLT STREE"1" LOS ALAMI'f05, CALIFORNIA 9o7zo PHONE 3�<�.799-9469 - FAX 3�0.799.9459 , Project /� ,�,i,,,,,,�,,, Date 9��5 y7 ` Address , �� y �� -' � Project Number �,/�S-9h G/7��✓.o—yi�.✓ �Y 7 �tS>i �S .�� 9'iLcr /Aiaoi ic l,r7es/7A9i r ,�O.fl <✓.8�� /r� Tow�.�f-r i.s�ooi2-' I '� � �».�isia9i�rs �f'✓// fi�� .�� -v � �.a-� /�so�.�— .tff-i •✓ —� � , , /Jx n vA' /�f �i/J� ..oa-i �rv .er.-� �J 9�✓Ji`6.+G 9< �-1 /a�'J1r-> ' i�-7 i . 9�w� /pf'�/"J��✓F� /OMSJ�J-cTis .._/ � Accepted by n , // / NorCal Representative - . �,�. -� `, �, � � � �r i t hi f�� '�:'C 9x N � R,C ��'L; � ENGINEERING � � �;�-1>..��,',.�^'�'`a:,::;�� SOILS AfV� GEOTECHIVICAL CONSULTAfYTS -�, ,. ,_. .;r.�. a�,.��t .,,., . .,..,� .s ,...,.,. 0 Project �� c- �J �+1`� � Address ' 3 7 5 �/" 3-1 % [ .� , s � /� n ,q, @ Field Observation Memo , VC � �o6q� HUMBOLT STREET . LOS ALAMITOS, CALIFORNIA 9o�7zo PHONE 3��-799-9469 - FAX 3�0.799�9459 Date S - / � ' S 7 Number G C�� -s1 U � J- -� � � � �; a ry � � � v �'t a ,,,.. a �- ;, .- c d � , � � �� "I� �. .-,��c+�..J � c.��rya.J �±,a f�<s^�n �,.�, / ,?iC` �_ � . '"r y,x= Ce s_�-jna�� nesa°`�i°'�'� i n. 1�1� .1 G�+'�' �. h`l�'J'-:">a �-'' d'r 1\-� �� q�l �i. �j. f]aN ��c��- S Iaa�� j � i�e..� a tl @ � C c}�^.1 •.. , t9 �� 1 c a�"h w^ �" G. t_ e d,1 �` j- ,'- ` y h '� e? a �. �'} :n � ✓jx a.%e �Y-, I�, ..1.. 1 i"� "'`J � cI � �. ,., n c.......- � e=> =�, � � �. j� J �. Y' � C . C -> '''; .^ � ; ;. � , i � Accepted by , � �� i �"^t ,�"",,,,�! NorCal Representative / r a � 7 � NO�.,RCAYIL�. � ENGINEERING � e �-� SOILS AN� GEOTECHNICAL CONSULTANTS G Address � . C � V 1 � � C 3 7� 2l S� .5—� C J ��"� ✓� � � Field Observation Memo �oGq� HUM130L1' STRHF_"1' LOS ALAMITOS. CALIFORNIA 9o7zo PHONE 3�0.799�94G9 - FAX g�o.799�9459 Date S � 1� - s Number �C Y � S �, /�. Cil� �--o ruc� �.. e�-.'f'�a� ��_ �`+ ; n, p �..� 'f- G i- •. J(i l� ` .� � r�^ a /�'- vs � a aP lj- ��- S' J^'1 � I G i-y,A.. 4 �� c r- � 1 /1.. C_ /J � o J. -N 5 0-. /' ° �+-� J � e J —�. />, , �I�J �,.� c L /dIQ w c .� i- t � -{ G .r �, h w i }- 1- p , � �o , ^ 1 �� C� C W 1� ��+�Ii- 'T %� ��1. I' , i%1. . �� / / � s i � r �d a.-j^� � � � .� J� � 7 . %� � 3 � � � ,fd'fh�� > > /�JQJ �,^�p�..). w•�� I�rc�,"ti �i1. �v'1. y ��u�.. '} S� 'e ti �. r, A—_ �'"G1 "i�e—�'r-- G S�.rt. S�i siJ / 1 � (�'� ��_ ' Accepted by NorCal Representative � '� � aoone.^ ar emiaxo: 3 7 9 21 S T 5 T 'ox*+Easx�EiF�+a�^+: NEWPORT HEIGHTS TWO AUDPES& 1501 WESTCLIFF #260 NEWPORT HEACH,CA 92660 631-7433 �vv�. �wiwo �no�ss: urcxrtEct on e++aa�tn: IPCR ON E110.'S ADDMESS: uc.,a: UNT: uwr: carm�crarsx.�PACIFIC GRAND CONST. (714)631-7433 cam�croaswuuxo 1501 WESTCLIFF �ooxess:N.H, CA uc.r+o.: 734964 92660 uxr: 260 LICFNSED COMNACTOHS DECLARATION; 1 Mreby Nim uMer pe�aly d prjury iMt I un IcenmE uMm pw'miona at CMqm a (�^�^0 wC� Seciim'1000) d Divi�ion 3 d Ns &rinm erd Vmfasiom Code. vd mY 4oeroe u m tu0 brta and eflatl. '" cmuc.No.:O O11 � uc.cuss: u�cN��4'96� „ EXP• 06/9$! . 1 Dele: CaNredor � � � / OWNEN BUILUEH DECtANRTION: I hxeby eM�m uMx pmWy d peejury Ihet 1 em wmq Imm IM Com we liorea lew lu Ihe idbv.+q rmfm (SeGion ]IX113 Bueipaa ud Adeaaima Cads: MY W a CpWY rAild� �aVu'um e G�Y lo mntrutl. aps.'unpw+. dwnd'nh. a ropv arry sVuclura. pior m Ya'saerce. e6o rpium tM epptirant la vich penM to fib e eqmd �Itlmwn tlW M u aM a lic«ued Wnuent io On pwvv�s d iM Coniradon lioeiue lew IChequ 9loommendM Mith Setlion 1000) d Orveian 3 d �hs Buane�a ad Prdeaum Codel or �!W M a eM u ewemq Iherahom eM IM bmi� la Ne dbOb uanqion. Iury vulmon d Seaion �wi.s M em md�� « e v� a4� �ne rodicem io. a�a �w�dry d �a maa inm, rn. numree dmen Issooll. , � I.mowmW�MpW�YrcmY�^VbJwewlhweO�ntlwiWeaomG�+e�ion.wAdolhexak.udtheWucnnaerc�iMeMeC a ollmedM veb (Seclion90M. Buvnew eM ProlmeimsCode: Tha Conirmae li�us lewAroe nd eGW loen owiw d pwenY who WiAs a in VA++Renm. end Mn dom urh wak 1'vnWl a MnM a Ovwp� he a Mr own amWwr. p'o+'� thm wN improvaneNs ve m�'vurEaE a aflred Iw We. tl. howeror, iM buJEinp a'vnpv.anaX u eold wilhm pp yeer d oompbion, Ne o.�.e�,uw win ne�e me d,ben a ww�w n. «.n. ed �a nma n�wa+�« me wm� a emel. .. � I. m o�ner d Iha popeM. em exdwvNJ mMretlnO xiN ficmeed canl�eclaa w mmtrW ihs Dr9� (5anun nIM. BueMeee eM a,aea� coae: me comreea. �.m. �w ms. oa rodr w m, ow�« a wwsnr •+�o e�wa. o. �wa� �� m,e .m convxb b axh p9�s wah e mnree«(�) Ikenasd v�uem �o ihe Com�mar. linme lew�. ' � I em erzemq uMw Sedion: B. 8 P.C.. br Nb isnaon: • i ao n�reW unM mm i.m ewm. a.�a �m..w,e me nc��ema a cmeomie M.enn .na sm.n code sen�. zsws. zssaa. ene 2553a. eM Nm I rc enY Mun buik'vq ¢u+D�� xill / wll m� (a�cb an) nseE �o canW wYh eeid tlels catlm aM tM nWimmaqe b aVammlammiruciianamod'dretionhantMAi�ii y�a^nYe^��Ob1riq.RaddaXelmMvfuneGP�iomeneRemqlmmiheaa c.w�.. ome: �vWc.m: WONKEN'S CONPENS�TION DECLAN�TION: I Mraby aNum uMer panMy d perjW me d Ne bAowi�p dademiiom: � I hew eM W manien a MY�e d mroenl lo �Nlimun br v.wFen' canVM�ion. n pwidad In M 9amm ])00 d tM lebar cod.. i« me oan�. a m...� r« w�n �M. �a A �.we. .fl in.v..mwi�meim.�xwks.�wmw��,��.�.�Aa�.ews.a:Ma�wdmetmo.cae..b,�neronamercea�n. li"" � la xfiidi ihia pwmA ie esuetl. MY w��n �mpeneabn imurer�cs mnw enE pdiry number are: c�..: STATE FUND EXPIRES Pe�� N�m�,,: 0 4/ 3 0/ 9 8 (ihis aeeian rieM ro! bs canpMed f fM perml ie Iw wre hurdmE ddlen /SIOJI a ba.) ❑ I cenM �nel in �ne panorinerce d iM wwk 1« whcn inie permit ie imueE, I ehell iwl employ env pe�wn in eny menn.r o m to bB1.'p11B Wh•Btl 10 �M NOf��Bft� COIIIpM18Bllp1 �9'M U� CB�I�qlll6. Bllf� COfM 1� d I b bBCqIM Wqd.� �O I�1G compenution mheione Sed'wn 3]00 W �M labor CoEe, I ehell lalhwil� oompy w�h �Zi�^ � Oale: �'Z M, %C%_ —� % ADV�kenl: _� — _ f` � _ _ _ �� T T�� Wemlrp: F��n ro � 4n wontsn'ronpr�utlon ew�rry� l� unbwf✓I, erttl �M/I WOhef en �mplqw fo eNMiul p�n�ltlu uM c/vll Ilroa up lo om �urOreC IMuurM tlollan 1SI00,0001, M eACltlon b M� cwl al romqrwtbn, Aemeps� �s provltleE br In Sxtlon J105 0/ 1M Lebor Cotls, IMwsal. �ntl �ttomry'� /w. CONSTFUCl10N LENUINO �QENCY: I Mreby elfirm uMer penely W perjury thei Ihero u e mruleWion kMiip paney br the peAormenca d iM xak la whiM ihe pamY e eweE (�� . C'v. CI. LENDEH'S NAME: �o/oen�s nooness: I cMily Ilut I hme red Nu epq'r.etion aM ama �het Ns ebwa'vdanW ian u cvntl. I qpro io oomply wilh ell �Yy enE miMy adi'wv:ee mM etme lexs rNmng b buiWvq conmunion eM Mreby eullwrixe rap�aeemeuvee d tAia tlry lo ema upon �M ebv.a�memionad papeny ��1n9pBdpopurpOe9RONALD LEGRAND � vNu wn» �- Uab: d•i ` , SqrielundO.mx/ AppGanLGonlretlu 7 (5151d6 WP) WhGa-Buikip 8 SBIery: OrearrFb: Cenary-Appitenl: Nnk-Rmenw: (bldenroF/uwvw .' � CITY OF COSTA MESA - BUZLLING PERMIT PERM NO: E 086701 PERMIT NO: E 086701 PLAN CHECK NO: N GOVT: N SUPP; Y CONSTRUCTION TYPE: PERMIT TYPE: ELE PURPOSE: ADD JOB DESCRIPTION ; CONVERT 155SF GARAGE AREA TO BONUS ROOM SQ FT: CLAIM VALUE; CALC-VALUE; GROUP OCC: R-3 / COMMENTS: CONVERT PART OF GARAGE AREA TO 155SF BONUS ROOM, ttB86699 at*�***atitat�**xitit*itat**�*�+�+��*�**�**+r+t��**�**x**,��r****�at*****�*�r**it�****�+�*rt�*�*iE Z O N I N G R E Q U I R E M E N T S S E T B A C K S ------------ MAIN BUILDING ---------- --------- ACCESSORY HUILDING --------- FRNT: FT IN REAR; FT IN FRNT: FT IN REAR: FT IN LEFT; FT IN RGHT: FT IN LEFT: FT IN RGHT: FT IN PARKING REQ: PROV: PARCEL: 42623228 ZNE: REF NO; PLANNING NOTES> i iF iE 1t iF iE iE iE iE iE iE 1t iE iE iE iE if it it 3E iE it if iE i6 iF k 1Elf �E aE iF 1k iE iE iE iE iE iE i(� iE iE iE iE ik iE it �F iE if 1E df * iE if iEiE if i! iE 3e if iE i! 3E jE iE �E iE jE �E i! jf iE if iE i6 iE it iE D E V E L O P M E N T S E R V I C E S R E Q U I R E M E N T S 20NZNG APPROVED BY . BUILDING APPROVED HY : APPLICATZON ISSUED BY if iE iE ib iE iE it if if it iE jE 1t it �1f ie iE �f iE ii iE LEGALIZATION:N BLUG PMT PLUMHING PERMIT PLAN ISSUE FEE F E E' S U M M A R Y ELECTRIC MECHANIC %.Q� 50� 6,50 DATE: DATE: DATE: � 2� iF"i�iFit*�t*it**it�*if e �x-�t- STRUCTURAL SEGMENT:N FIRE SMIP/RES GRADING SMZP/NON-RES BUILDING-DZ��-> PERMIT ISSUE PLAN-CHECK TOTAL PAID DUE TOTALS----> 7.00 6.50 0.00 13.50 13.50 .00 REVENUE DIVISION TOTALS--> COLLECTED: 13.50 OVER/SHORT: .00 BLDG PMT PLUMBING ELECTRIC MECHANIC FIRE SMIP/TOT GRADZNG PLAN-CHECK 13.50 '1E'lE 3f 3E 3E iE iE')E 1E dE iE # if'lE iE iE'� 3E'1k ik if if iF 1f iE'1E iE 8f if iE if 1E if i! �E iE if'lE iE iE �1F iE if iE iE iE iI' if'1f')f')f')k iF iE if'K"%jE'14.'k iE'1E iF 3E if iE'�I"1E if iF iE i!'lE if iF ih if 3f if I N D I V I D U A L F E E B R E A K D O W N TYPE QTY D E 5 C R I P T I O N UNIT COST TOTAL COST ELE 1 FIXTURES, LIGHTING 1 ST 20 EA. 1.00 1.00 ELE 5 RECEPT/OUTL�T 1 ST 20 EA. 1.00 5,00 ELE 1 RECEPT/SWITCH 1 ST 20 EA. 1.00 1.00 END OF FEES 81-2't-199A/18:54 M/f13.58 RCPTN:91-B818567 PERp1IT:986791 J CONSTRUCTION AND PLANNING POOI ts SPA '� � � APPROVAIS Permit # Date Inspector APPROVALS Permit ah Date Inspector i. TemOorary Electricai Service or Poie 52. Pooi & Equipment Location; � 2. Soil Pipe•Undrgrnd. � 53. Steel fleinforcement . � 3. Electrical Conduit Utitity-Undrgrnd. 54. Forms 4. Electrical Conduit-Undrgrnd. . 55. Electrical Bonding ' . 5. Steet Reinforcement 56. Rough Plumbing & Pressure Test 6. Elect��cal UFER Grnd. 57. APPROVAL TO COVER•GUNITE i 7. Footings 58. Electrical Conduit•Undrgrnd. 8. Foundation 59. Gas Pipe, � Undryrnd., Test �� 9. Water Pipe�Undrgrnd. � 60. Backwash Lines, P•Trap, ��Jndrgrnd. 10. Structural Floor System , 67. APPROVAL TO DECK : 71. Property Sewer Line & House Connection 62. Backwash & Receptor-Final r, , 12. Sewev Cap � 63. Heater & Vent�Final ," 13. Roof Drains -,:, 64. Plumbing System � Final � 14. flough Plumbing � 65. Etectrical-Finai � 15. Fough Electrical�Conduit ��/:; 66. Solar System-Final ' � • ; 16. Rough ElecTric Wiring �ji�%M- ��a. 67. Fencing & Access ApProval .� z1pLl (_I� 77. Rough Wiring Sign „td,4;� 68,-APPROVED FOR PLAST.ER.ING � ---�� " � 18. Rough Electriwl-T Bar Ceiling 69. POOL/SPA SYSTEMS FINAL 19. Rough Heating & Air Conditioning FIRE DEPT. REQUIREMENT 20. Rough Factory Fireplace APPROVALS. Permit #. 21. Duas,in Structure 70. Underground Hydro � 22. Ducts. Ventilating 7). Product Piping QGas ❑Oil 23. Gas Pipe-Rough & Test 72. Undecground Flush 24. Roof Framing 73. Undergrnd. Storage Tank O Gas ❑ Oil 25. Roof Sheathing 74. Overhead Hydro 26. T•Bar Ceiling IStructural) & Monocoat , 75. Dry Chernical � ' 27. Frame and Flashing 76. Dry Standpipe 28. Lathing & Siding 77. FIXED SYSTEM FINAL 29. Insuletion � 78. FIRE PREV. FINAL 30. Drywall Nailing HEALTH DEPT. REQUIREMENT 37. Plaster Brown Coat 79. FINAL INSPECTION 32. Elect�ical Power Meter-Final 8 FOOD CERTIFICATE ISSUED 33. Final Eleciric ' tes: 34. Final Heating & Air Conditioning . 35. Final Gas Pipe-Test . ' 36. Hood or Canopy � - 37. Final Faaory Fireplace 38. Final Plumbing ' 39. Water Service-Final . 40. Gas Service-Final 41. Solar pomesticFinal 42. Back4low Preventer • 43. Backflow Irrigation 44. Landscape Irrigation System � 45. Sound Attenuation �„ ' � d� 46. HandicaP Regulations - r 47. FINAL STRUCTURE & BUILDING z• -� 48. FINAL PLANNING 4 � " " :: i?3 49. Electric Release to Edison -� � 50. Gas Release to Southern California Gas Cn ::,'_ ; 51. CER7IFICATE OF OCCUPANCY No Date eoon6ss o,aem�pra: j� y L l$ 1' :i T a�„ercsw�hiviwwm: N�tivF�Ok7 ii75 'iw0 � �0°"�g l�vl w'�STCi.1r'F � N.d. 5iG6"v �vc�. iuuw�o �oo�ss: UN�: YKNRECTORFNlixEEP: (�(�UV15 i:NGiNrtii.[nli.; �'�" U u�cxonr„us.00�: qd'vG CAMPiiS Lk uxr: � N.b. CA 92uGG ��r�� f�AC Y r':i i; i;iih.NL �i�iv5'i . ( 714 i 6 31-'i 9 3 3 coxm�croxs�uw+o 1[i V 1 WES 11:L1 i� 1� �ooxess iv . ii . Cli uc ra_ i 3 4 9 u 9 7LbbV �: 2u"v IJCEN4E0 COMP�CfOR4 DECIAFATION: 1 lw�eby elfrm wtls penNy d per�uy Net I em ficmW wder po�i�ime d GMqx B (mmmsnt q�wth SxYm ]000) d Oi�"vion 3 M IM B�ev end Prolueue Cods. aM mY bas b'u� hA 4m wd Mlatl. � 070iib uc.cuss: uc.No.: ')j,yybq c E�ii"r�• Gtii//`��" Dme: Camadm �� ) i �//�.r+�✓`C o euuoen oecunanoN: i nreW ercmm �ma. pewy a perj.y u,a i.m .omp hvm m. corcmuon �k«.. �.r �n m. ��m� (�� ]�15 B�nineaa wd P�dsaaae Cods: ��V dY a mWy WJN �pWw a pwm0 to mubuU. aCw.'vnpwa. demd"eR a �apv eiry attucuve, pv b l+ ewarin, eLm reqimu Ne eppfiufa lor eueh penes �0 0e e qisC uetsnaN tlW M a�Ir ike�..e w�n io in, a� a n» cum�.eo., u�w i.. �cnma e c��ro wen swo� �aaol a a.:n� s a iro u"vim eM Rdm'ne COEe� a Ne� Ir a ahe e uemq tMeNm� xM tM bem br tlr ebpeE nempun My viduion d Swm ,pt.5 b/ e�ry eppl"raM la e permn aiEpG� IM eppfrau to e wi perepy d nal mvs ihen fxa hund�ed Edlen �f500n. ❑ I.tlaxnerMtlapWMYRm�'enqo�+eaxihwq�eatlUsebcvmpmmtm.WdotheMvkendiM�NCEvownalitlardeC a onerea �«.de (s«rim �aa. e��n ene Pmtmaioin coee: me cavreen. timma lewewe na apvN �o e� owiw d�.operry Mip bl�f IX RTC�wA 1�1MBRI. GIIQ WD �� BIM�I �1V�[ hYllfl� IX �Wfl� IX bl101q�l �M R �Mf OWII MIIpO�OY�. V�w�11�101 flC�l 'mpowmema va na ineiMed a allaed la eeb. tl, Mw�s.er, �M Wnitlinp a inpomnw e wid rrilhn ar yw d mmplelion. Me owrorbuidx x�ll Mvs �M WNn d Pa+M M a Me NC M dWd a imP� lo Ne W�D� tl aM). . � I. ea ovmar d IM pW��Y. em ezNvrvMy mYrr]�q xVA fi�ved omUeclan b mntrW IM pNb (SWion 1011. Bwi�qs� end Pmtnaiom Code: TM Cauratlon Isma law doa �w epply b en oxner d popMy wM10 bWtls a Impwa �hason and Wv convena 1« ad� pdala wah e mn�ee«Is) fmmed o�� m �Ir Cavbam lioero� law�. � � I am uemp uMx Section: B. 8 P.C.. br Nu rmaon: . Dme: ��: � I eo nereM ceniy ihet I em ewue a vd uMe�sierd the n9uinmenu a Celianle HeeAn eM 8elat�/ Coda 6eabm u5o5.253a'f, end 25531. enC Nel I a ury Mvra dikinp omWem xi0 / wil �w (�.vck aa) roW W candY wYn uid qtle aoda� enE IM nVuinmaM br apsmnl«mmmKtimamoddraiionhdn�MAi u�y.eneprneMObtrie.RetldentWomuivaunappfu�ioroenarwmqlmmlhua panabru. :� Dme: �pp«: WOFKEN'S COYPp14�T10N OKL�RATION: I haraby affvm ivds px�My d pspry ons d IM bOoMrp Aetluelum: ❑ �newene.:�mewen.e.nrm.dom.un�o.wunu.ror.axen�mnpe�umtn.na�btaM9ativna�aoa�neLenor COM. iw IM pAmvrca d Na xak br vNch Mu pamY e mueC. J"I in.».oaw�a.�.�«.•�w��,�...�.ameewsww�a�ooameima.coa..m.m.v.�amw.am. 7� woni �a .nicn mu o«ma b en.e. Mr rwi.� mnos.tlian ewv.nc. mri. w wW nume. x.: c�,�. Sihir' riiNu 6XPIiiES vorrrr�n..: 77447'tiOf�li.iF.i.R V4�3V�58 �. waa� M.e,wr w o,w�r.a � u» v.� a ro, d. ro,m.n mw. maol o. w.l �] 1 !y thm in iM pMamvrw d �M waM br v.Tich Nu pemiu o u�uaE. I NN nd ampb� erc� perwn N ury mannw w m lo �e abjotl to �M wkaY �ian Isw d GeHomie, vN amw tlW � I�hwld bcmr wbjotl �o wAm��' com maiian p'wie ns d ion SI00 d �M leEv Cods, l tluA�� od.� �ovr�v: V w v:c.uw.ro.«w..onr..•mr�.u.d0000e.r.a.�,w..w.w.wn.�eNn.n«ro�oy«roemN�ro.n.ro..aa n n�., w ro m. n�rdna mou.w eorrn (tiWaooA a.auuon ro m. m.� or m�«wnen w�.c.. o pcvw.e ror in s�cam 9109 or M l�Eor Cob. IN�c md �tfonMl'1 /w�. CONSTIiUC110N IENDINO AUENCY: I IsaEy eKum wMa perc�y d perjuy INI IMn b a ampiutlon bnNnp yprcy br tM peNmnvw d IM wark b xfiirA Oie pwml u enwd (Saeion ]041. Cw. Cl. �ENDEP'S NMIE: , LENDEN'S ADDNE55: � o.wr inm i n..e nee w. eoo�•�d em. �w c» mo.. wamunn u omw. � ro�« �o oomoN.vn.n en.�e mw+r w:ww. eM ele�a le� rele1M lo dnkiq eavo-�qian md MeeGYau1M¢s repraaaqeurm d IAo �Y b Mw Wm IM Nwa�maNionad pmpmly i« ��sc«Tm wuv�«. . x�NALD ;�EGicAivD (5151.�8 W P) �A�uiWiq 8 Sefery: Pink-Rs.enw: OddenioFMeeuor CIiY GF CuSTA Mi.SIi -�801;4a�TNG i�i3itMIT PtRMIi Nii: r; "v6Sv93 P7,AN CIi�CA Ni): iJ PERM Nii• ii Od�ii9's GV"vl: iv :il3FC'; N I,VfVJARVL�IIl.11V lYYh; V—jV YL!<Ml�f lYi'L: �:l.l•. Y1.%I<k'l/:il:; IVr.N! :i�ia LE�l.111Y1'jllN : LZVSSY SSNGi.t; i�AM'iLY Kiis'Cu. :in7�F i;t1RAi;c: SQ 'r"i : CiAtM VALUt: i:ALC--VA7,Ut: �t'<OU!% OCC: li-�s / Ci�MMr'iViS: R£"r:i"t-8�i171 . . �.�.�� ,a�G.,t-kr �.... . .. .. .. .. 'RRT'f1t'R�f�]tf�R'h'illt'RYlit'�YRII"R1tRRltltftl�ltl! f! R 1tl�f�w 'RtRI�' T' 9t1tYFf!)FJt1P'RRiYT'�tT'ItR'RItA'KT'!1'1Cl�R'ItT'A"RR � G N I N G k� Q u Y ti i M'r. N i S S E i b A � ii 5 •------------- M�1N nUILUING ----------�-- --------- AC�F.SSuiiY tSlI1LL1Nla — '- FkNi: Fi 31v kEtlic; rI iIv ckNi: "ri IN ictAic: ri iiJ LEt'i : r i it3 HGii'i ; "rT Tiv LCtT: r 1 IN ic�iil : rI �iv PFticiili3G ite;Q: I•iiuV; eAFcCe;L: GuGuvOGv civfi; n�.'r Nu: Fli1�1vNiN� Nu'i65> 1 � 'lt'IF 1t Itjt ft 1t 1t ft f! Yt 1l"1\' 1t ft 1!'R lt R 1' 1t lt x lt lt 1t iR'RT R 1' f"!t�'/t 1t It'�Fi! 1F I�YF f! l� lt 9� 1!'�l' 9F'R R A' iR 1t )t'h 1t1! 1t f1' it'R i' it lr R Jt'R'1! 1�' lt i�' lY'!Y 1T- It A' R'R R u E v �. i v r M t N i n t't"t v i � r. 5 h r c,j u I ri i M r. iv 'i 5- 'LlJN1Nl'� AYFRiiUc.0 UY LI:1L•7 ' ' '� �"'___ � HuILi�IN� I�Yk'1tVVhL nY : -, liAit; ` --- _ _.'-' --'-' ' . '.i -- ----- Ai�rLI�Ai1vN is5uhu tiit. uA-iI•:: 0.� 1�l''R1tYtYtltlt'%tltltiRYF1lYtYl1l�f'RiR1�RRR'Tlt1tYYN'Rk'Rflall!'RflftR]'RY�YYYY '?'R hfi �'R1lIY1t1F%FT'ititA'��1'' k YY 'Rl'� LEGALIZA'fIGN:N f"r_�E s U M M��'�� S'iRUC'iUiil�i� :>iS�>MF;N'i:N Ff�,LG �MY 1'Ll1MEflNla £L�;CIFtI� Mr:Ci(Aivit: i�.iiir: SMIt'iiiE:i t>fiHii.iNv PERMY'1" 1 2 5. 4 G S"vt SMIP/N�)N •xiE:S PLAiv TSSU� "rr:i: 22, "v"v LtUlL1J1NG-•L1V-> YERMIT iSSOi rLAN-CHr.�IC "iviHi, PAfii uii� Ti�Y'AZS-----> 125.4G 22.G"v G.G"v 197.qG 1�1'J.4'v .`v'v F<tVENiIE uTVY5ii7N 'iiiIALS--> CGiLEi:'iEL: 14'7.4"v i)'v'r;i�iaHiifc'i: .00 bLL� FMf FL'UMbINi; EL'EC1'RTC MECIiANIC i�"iiir. SM:ie'iiii.i �iiAiilN� e'i,AN-CiirCri 14'/.tiV '? R R 1t l' 1t l� l! f� R'R x'R R'R T lt 1� R l! 1! Yt'R R'/! l! w R R'R R R lt 1t 1R 1� 1� 1� It ltT'R ]t'R 1t R"/F fI' lF'R 1t lt'K'A' RT' R 1� H' X 1' l''R YF T' )F 1F 1t f�')t )t F R R f1' R Yt R R l iv ii i V I L U A L t� r: u R ii A ri ii U W N I�tF�. �Lt. iiLE tLE EI,E ELY. QY'Y ii E S C R I r I i�i N iJivi i i:OS'i 1 r'LitTiiRtS, LIGiiTYNi; 1 S'I 2"v t'ia. i."v'v [ i"tFC6r'i iOUTLti 1 51' 2G EA. t.OG i xECF.r'iiSWIii:H 1 ST [� eA. 1.�'v 1 MGYGit i i•OWii APPARA YUS G. u -� 1"v iP 4. 2 5 �32s Nr.w RES BLUG E'iik 3r UN.[Y'S�i �`C� .u5 �Nii u'r' � �} � D ' �' ��C I � $ �99/ C�Ty pF COSTA MESA lVllil. l.11S1 1. Vll L.VV %.VV A.G� 116.15 � z - � 'CONSTRUCTION AND PLANNING POOL 'A APPROVALS Permit# Date Inspector p�ppROVALS Permit# Date� Inspector �� 1. TemporarY Electrical Service or Pole 52. Pool & Equipment Location 2. Soil Pipe-Undrgrnd. 53. Steei Reinforcement -3.• Hectrical.Co�duii Utiliry-Undrgrnd. 54. Forms � "4"Electrical�Conduit-tJnBrgrnd. 55. Electrical Bonding � �-b'-., Steel Reinforceme¢t 56. Rough Plumbing & Pressure Test '�g'. �IectricahlJ�ER Grnd. 57. APPROVAL TO COVER•GUlVITE � i/i Pootings �, � _� 58. Electrical ConduiPLJndrgrnd. �8' Foundation- _, � 59. Gas Pipe, O Undrgtncl., Test 9. Warer PipC-Undr{jmd. ;� � 60. Backwash Lines�RTrap, O.Undr�rnd. 70. Structural Floor Svstem 67. APPROVAL T�QECK 11. Property 5ewer Line.& Nouee-Connection 62. Backwash & Rece�ytor-Fina� 12. Sewer Cap � ` . 63. Heater & Vent�Final 13. Root Drains :. _ 64. Plumbing System � F�nal � 14. Rough Plumbing 65. EleCtricai•Final 15. Rough Electrical�Co�duit ; •� •, Solar Svstem-Fin� 16. Rough Elearic Idl,iring _ > � ��d/ I 67 ^encing & RcceE4-Approval 17. Rou h Wirin Si n � /l 9 9 9 68. APPROVED FC�RPLASTERING 18. Rough Electrical�T Bar Ceiting �69. POOL/SPA SYSTEMS FINAL . 19.'Rough Neating & Rir Conditioning r � n�, _ FIjiE Q�EPT..9EQUIREMENT _ _ 20. �ougti Faitory'Ficodlace � � _ _ =�; .'qPPf{'DVpity�-� � Perinit #��- ci n 21 . Buctr in 9trui'turer + ^ '• - � - `_ y � y 70. S')nderglo�o'Ff HVdru � . 22. Oucts� Vqntilaiing : � ;. � � -i �t :; 71. Produot, ,�iing O6as E50i1 23. Gas P'hpe�Rough & Tesc � _ ^- : r Y -� �� 72, Undergroynd FI,',d5� '� - 24. Aoof=fra�l�ng" r' " , '� T _ ', 73r Underyrrid. Stor3�.� Tank.O Gasy � OiV � �� 25. Roof-ShedIhing :: � � � • : _ �, = � 74:� Overhead Hydr� „ r 26. T'Bar�Ceiling (Strdc'tGra11 & A�brncoa� ; , � '� ' 7� Dry Chemical _ � `' � ' �� - - - a 27. frame and Flashing : � - ; r � • • 76. Dry 5[an�pipe „� • + ,� - _ '28. Lathmg �i�Siding " ' _ _ � '• �� 7?,� FIXEO �'s`yTE1�1=rINA� .. .1 n � - � 29. Insulation' � - - .. . � + � I !`� 7� FIRE PREV. FINFZL - ^ '� �� 30. Drywall N�iling ; y ' , � � s l,'1E°,ALTN,SEP�.�REQUIRECftC$!7 ` � 31 . Plaster 8r9wn Coat � � � , , I � � T---� - - ' 9. FINAL IWS�ECTtOM .� J �4 . �� 1� ^, �n ; 32. �iectrical`Powzr MeterFiryal �/�� _ _�' I p yF00D CERTIFFCA'i� I�$L-ED_. ; _ 33. F,;nat��leetric-. :! - �`� f� V� N6tes: . - �� . . _ � � _ , !. .1.. -- - � �. + �34. PinaFlieating & Av Condltioning = � • � • � ' � • � � =� r _ _ - ' , ��. � _ -' -� 35. Finai Gas�iPe�Test �. � .: ; ' 1 �' � � � 1 t ' � � � : ' �36. Hoodor CanoPY � . :. .. ' ' i I` - � - . - .37. F.inal.FacFory Fireplace � _ = F " � ��. - � � '38. Final _Plumbing � � , S � _. '39. Water Ser�ce�Final � .- '. ; - ' . - - - � - '40. Gas Servite�Final • � ' � � T. � � ^- = -' • • - " � � k . .� ✓ -47. SolarpoKestic�Final' . ' • " - ��= - , z - A2. Backfiow Preventer • '+ r , • - _ _ - ' 1 '1 . L� 0 T f. � 43. Backflow frriga'tion ' , S . z - � ' • • 44. Landscape Irrigation��System - T � - � � - = = ° �? � - � -� - = � - - - . �� i - . 45. Sound Attenuation ; � "'- � - - _ - ` - -�� - 4.6. Nandicap Regulations - - , _ _ = - : � � � C �j 47. FiNAL S7RUCTURE & BUILDING ' _ ' � _ 48. FINAL PLANNING • ' . - • ' 49. Electric Release to EQison 3 , ' 50. Gas flelease ro Southem Cali(ornia Gas Co -' - • �' ' 51�. CERTIPICATE OF OCCUPANCY• -' • � ' ' � . No._ Date BUILDING PERMIT LOG f NUMBER: TYPE OF PERMIT: TION: S�UARE FOOTAGE: f FEES: JE ADDRESS PER SHEET- TIME IS TO BE BE AS SPECIFIC AS POSSIBLE IN RECORI wbnEseoFewiou+a 3% y 21 S"1 S 1 'owxF'pSNu1�6a�owN: f�t;yjF'V�t�! lI1:J 141U '�' woxEss: j)V1 �MtS'll.t,�ltr � N,.li, �LbbV �vvt. wu�wc �bo�ss: uNr: MCXITELTONFlltlNEEA: (�VI.IVIJ iilvi;ZNrtii't"LNG "G"�.: u �xcx.onexc.�s�oonEss: 4�i V V l'AMi'lIS Llt uNT: N.b. �A 9?.6ii"v c«+m.crars r,.�: PA� l F' :C C Gtt/�IVL CiiNSI . ('i 14 i � 31 - 7 9� 3 caxm�c*oxs wuiwc t� u 1 �W k::.i 1 l:i t F�r wonest N.!f . CA uc. rio.: �/ .i ti 9 b� 526ou uNr: 2uG LICENSED CONTPRCTOPS OECLAHATION: I �areby eMim urtlx penehy d perlury ihet I vn licemed uMm powion� d CM1eqx 9 (ownme�eq wil� Sedion )OW) d Oiviaion � d ihe Bueirem ud PMesaiorp Code. arM my lieenae ro in lull bree vd eHW. u No:G'%VI �y uacuss: uc.N/o.:/ �349/`a"y♦�.�! EX/�}� Gb/ 8 De1e: Conveua: �/"�iai✓.+y7 Z. L/�( � i EP BUILDEfl DE IAN/ ION: I Mreby elfirm under peneXy d perNN �hm I em eKemq Irom iM ConVedae Licenee lew la ihe Iolbxin8 ��m^ 1�� ]031 S Buni�eas eM Profmaiona Code: Airy ciry a counry whidi mpuire� a pcmn �o emauun. Nx. improve. Eamdsh, a repei eny rruciwe. qia b its'swarce, a6o repuiree the epplicem la euch pe�mn to Rb e ep�wE eletemenl tlet M a eM '. IieenseE purauent lo iM povieiam d ihe Conlreqae Lieanae Lew �Cheqx 8(eomme�ep wnh Swion )000) d OMeion 3 d Iha �sir�eaa eM PrMessona Code� or Ihel ha or ehe is exemq therelrom end the bavis �or the elbpeE exemption. My voleton ol Sedion 031.5 by eny epplirant ta e permn wbptlf tM epplicenl lo e tivil penelly d ml mae Ihen frve huMnd doAen �5500�. � I.esoxnerdtMpeopaiiYormY�WW�a�hwepesav�Misdeoxnpenselbn_vnllEolhexwk.eMlMeWe�unum�inteMed impmvemmle are nd intenEed w dIe2E ta sab. p. howv+er. IM Witlinp a inpwemeM o eoN xilM1in wpY^v d mmplelon. Me wner-Wikbr vnll heve iM buNen d paving he or eha did r�a buik or imprwe f« tM W�O�e d eele�. � I. ro ox+rer d ihe D�VeM. em ud siveN �n�rennY xnh liiansed conVec�ae ro iw��ue tln p4� (Sxfion 101.. &»inme end Pmlemiorw COLe:,The Camrmon L'r.ense law doee iw eVWY �o en awror d poG+�Y Wa buitle or'unP�'�� ihaaan and who conirecro Iw eudi Oropda wilh e canireaor(s) IcenuE punueni io ihe Cantretion �icenee lewl. � I em eumpl uMm Seciion: B. 8 P.C.. br thia raawn: ^. i ' � Daie: ' Ovrter. . i eo nereM �r mm i em ewue a ane ��nu�e me rea��,ew a ce�romie ii.enn d,e sero�r coee seaons zsws, zsss+..�e 2553a. eM thm 1 a em� Mure Wiki�q xapam vrill / xil m� (orcb me) need to camply wth eeid naie oodn erd the repuiremeMe br epermnlacanwnionamodificetonhamtM�i ie3�F�iy anepemeMDielnd.RmiEaMidmna�iudioneppfu�unearee�emplramtMee provisiona. Dete: ApplireM: WOPKEF'S COMPENSATION DECLAHITION: I hersby elfirm uMx preXy d pujuy ar d Na Idbwinp detlarelom: ❑ IlwaeedMilmeimen.eenfrai.aomxntlo.elt�ireurebrr.akme'eamDe�ian.oV��IwMSemm3laoM�MLeEn Coda, lor iM pe�wmence M Ne wwk Iw wtieh ihie pemin ia iauad. .[l ine�ad,e�;��md,.en�a.•�v��w�.e+roaw�aeysm�e�wdu»tmo.coeo.amow�«�em. 7� work Iw xfiidi Nia pemiil o eaueE. MY wwke�s' mmpenaetun imureMe ranix vd pdiry numbx are: c�e,: �'iA7� ri1Nu � E}(PItiES PdiryNumber: �i �I%�1�11�IC1 hi^I�h�S{- �JQ/3�J�CJ(� ,;: s«+;o� ,,.ee,�a se mna�<e. rrre ro�. n m, o� n��aree eww� mool o..�s..� �] 1 cenity thet in Ihe peiformerce d �M vrork br xfich thie pe�mn u iaeued, I Mell � emply� vry pseon in eiry menner eo sv b become wbjae to IM whera' canpenembn kMe d Celifaide. eM eprae Net il ehouN be�ome wbpd ta tM /w/keee' pemaiian om �siwn a aulan a)oo d in.lnbw code. � ahel� �on n mmah inwe omviaion+�.0 e: AGV�iranl: � ilip: F�llu b,eeun wortni rompeiustlon cmerap� l� vnlax?ul, uM alW/ aW/�ef en arplqw ro e� clvll Hrw up ro ons hu�arotl tMuurM JWNr� (Sf00,000A In elalfbn ro M� cwt al compeiwflon, Mmps� u poHdeO ror In Sxtlon 3]P6 0l ths laba� COM, lntwt, erM efromsy'� Nsa CONSTPUCTION LENDINO AGENCY: I MnW elfirm u�der penely W perjury Rat iMm e e mmtrud'wn bMi�p epav,y /a Ihe perlormeae al �ha wM lor which t�b permi ie esuetl I�bn 3ae]. Civ. CI. LENDEfl'S NIW E: , LENpEN'S �ODRESS: I ceNity thm I have reeE Nis eppliutian eM pma thei Na ebova iM«metion ia canea. I eprea lo compy wilh all ay eM oouMy adinencm eM stale tev.s mWiq io buiN'vq mnawebn end hereby aulhorize repeeen�etivea d iho dry io emx upon IM ebv.e-meMioried popmry lor inapenion purposes. , ,_ . 1t�N1��,U L�i;i'tANii nt NemeI! / `i <"L, . Dete: � �� SpneWradOwmr/I.penURppMan aT� (5151-a6.W P) W�ile-BuiWvp d Sal&y: Gneri-Fla; Cenery�-AppS enl: Pink-Fevenue: GOICmrod-Nwwr CITY GF COSTA MESA - BUI:L1i:f.NG Pt,RM:IT � I�F.RMl'i NU: P "v&Sv95 ri,P.hi CIi�.CK tv0: n ��;.t<M No: r �aso��s liIJV�L; lV ;.ilJk'2': N �GIvS'1RiJC"iIciN 'iYF�: v—iJ 1'F.t(MI`1 lYYF.; YLII rCiiif�ii:��: tii•:W Jl.1H U�S1:171F"Ill1N ; L1VJS!' SZNi�i�: k/1MILY K�S�IU, '�75%JC liAlll�lit. SS,,1 t'1: LLAIM VALUF: i:ALC-'VALUY:: tiftiiUY i�Ci:: H--3 % CVMMfiNTS: KEr:b-$SG"it i4 ii ie ie iE if ie ie iii't ie ie if ie ii i't �f iF if 'vP'rF it ii ii w iF�le'vE ie �if it ie ie R i't i! i'r'vi 9f ii'rf i'r ie ie ie ii �rt'se i'if iF �iE :f ie ik i'r x i'r ic�R'rF�ie ie ie iF i'r �i't ic ii� w• ii� �ie ie w� ie ii w-�ii� i'r i G tv Y N � h E� Ci i ic is M'r, N'i ::� 5� T b A � ri 5 -------�----- MATN bUli,u2NG ------�------ --------- ACCESSiiiiY bi.ill�iiiNi; ---.__---- EHNT: 'r'!.' 1N k�,iUt: 'rT 1N F'%NT: 'r'7 'LN iii;An: rT TN LEF'i': F'7' LN itGHl: 'r1' IN L�'r'"i; r'i IN ii�'ti'i: "rT iN PARrTN� Rt,y�: Pkvv; YAIt�"r:L: uii0Gu0u"v iNE: i<c:F tvG: FLANNINC Nt7iE5> i e.. > if ie ii ii iF if i'e ii if'�ii�'rF di ii ie ii ie �w ie'v'r iE'sF�7F iE i'r if i'r R w iF ie if i'r if ii ii ii ii ii'rf'ii if ii ii'vF �Je iF iF ie ie ie RiF iFii iFir i'r if �if iE ie'sr le ie ieie ii� l'r if �r� w�ie ��'ve iFie ie iF ii L'r.:-ii 'r". L ii r M E: N T 5 t k V I c; k S� it r: Q U I it 'r.' M� rv '.i 5 • r' . , � LC11V11V1i ArrkuVtu t1Y llH�IE: UOILLING'APYK(./VEU 6Y : � LHlii: i, . .' . ._ __ _ __ ". . . .. . " " ArrLiCATI�N lsSUiU bY: ^ iiA:�li: iFif'vfifii+}#ie%tiiiii'eifiiii'riifiiieiiifiixxnsexxx�w w x w x x�w �w ww k�tfFA'ifRif�RitTiiil�lFRlt'�Se� � x xyrx' if iEGALI'LA7IirN:N F' d t 5 U M M 1't Y ;ifRUlLUK1�L �iiGMtNY:N bLDG rMT YLUMbING EL'r.C'iNTC �Mi;CilAivii: FTItfi SM1PiliE:i �YtAu:iN� r•6iiM i'f 10 9. 7 5 2 S t �MIY /NIJN �-RY:S FLP.t�i 1S:JUh I'hF. LL.VV i+UiLLIN�•�LIV-> PERH't'f I�SUE rLAN-CH�i:lti iviHL l�ALf) Lil� 'tO1'AI,S-----> 1G9.'iS 22."v'v G.0"v i9.L.75 L91.'75 ,"v"v RF:VENUE L"tViSI�N TOTALS---> COLLECC�"U: 191.75 i)Vl:lt/SfiUtt'1: ."vG HLUG PMT FLUMbTN� tLfiC'Ihti: MECHANIC i�.ittE SMIr/iO'i vliAD:iN�; eLAiJ-CIi1:Cri 191.75 iF iF ii i@9f ii iE if ii i'r ii iR iQ'vi'vF iE if ii�%� i'r iF ie ii ie ii iF ii ii iF ii ie'sFif ie ii � ie ii iF�'vf ii it if iF if ;i if ii� ieie'v't iF �7E i't ie it �rt�if X� ii iF ir if :i x x�k 3F rt 3't iE "rE'r'r i'r ir iE ir ii i N L I V I u U A L F ti F, d R e. A K i� ii W N 'iilY�. ufY D t S i: Ft I i� Y 3 v N �� ^^�� uNi'i' �ii5'i t'ti'iAi �O5'f FLU 1 BA'fH':iiiu D 8,"i5 u.'7� rT,U i L:iS}iWIiSHN"R D 8. "/S t3.7S YLI3 1 LAUNliI'tY 'IU5 i�Ft WASH' OCT O$ �99� �•�� 8."i 7 eLiJ 3 SfiUr7Eft u."i5 iii.2� P(,0 I .ri'iivli, KIi'i:HEN 8.'/5 $.'JS �Lu i wnsi� 6AsTN CITY OF COSTA MESA �•��' ��" Fiii 2 WA:iti uA51N iS�.ii B."i� 1'i.iv F'LU ! WA1'�H CLUSE'1' ifOIL�:'ii 3.'l� 1i;.�S FT.G 1 'riAiEk riEA'Itlt ANU/Ok Vr:NT 11. "vu Ll.vu PLU 1 wA"Cr:h SEkVICE i3,75 u,75 E�LU 1 �A3 PiYTNG SY3 O"r L TO 9 u0'ii:.t'�S �.Su �.Sv ,,,�COVSTHUCTION AND PLANNING / POOL 'A ' RPPROVAL5 Permit# Date Inspector qppROVALS Permit# ' Date i Inspector � ; i. Tem,porary Eleitrical Service or Pole 52. Pool & Equipment Location i 2. Soil Pipe-Undrgrnd. ' �� 3 �� 3. Steel Reinforcement � �-�3. Hectrical.Conduiz-Ut�tity-Undrgmd. � 54. Forms _ .y 4.' Electrical Conduii4�n8rgmd. 55. Electricai Bonding _ ��5� Steel Reinforcemept . 56. Rough Pi�mbing & Pressure Test `-� Electrical UEERCGrnd. � 57. APPROVALTOCOVER�GUNITE ' . , l7_: Pootin9s-� } r; 58. Electricai ConduibUndrgrnd. c8:" Poundatiof= - � �^ 59. Gas Pipe, O UndrQrnd., Test - . �� .... - " .* _F r� � 9. 4Vater Pipe-Und!fj�nd. ,j .�,.�_ q _ 58--Backwash Lines_P�Trap, V Undrgmd. �-/ L 70. Structural Pioor'Svstem � 61. APPROVALT6QECK . . 11. Property Sewer Line & House;Connection J� J 7 b[, Backwash & ReceHtor-Final � 72. Sewer Cap ' c� A/�O� 63. Heater & Vent-Final 13_ Roof Draine : ' ' 64. Plum6ing SYstem � Final 74.� ftough Piumbing- " , 65. Electrica6Final , 15. Rou9h ElectricA��or;duit : . . � . 66. Solar Svstem-Fi.gaJ. 16. Rough Eiectric 1�irinQ, ;� � � � 67. Fencing & Acce3s-Approval 77. Rough Wiring Sign � - , � 68. APPROVED F01t�P�ASTERING 78. RoughElectrical;�TBarCeiling� ` - � � 69. POOL/SPASYSTEMSFINAI � 19. Rou�h Heating & Air Conditioningy� -; ,y � - � F1AE pEPT...�iEQUIREMENT .. _ _ _ . 20. Etough Fa�ctor� Ficaplace � c � ^' ° =� � � ° �APPF�,OVei,L$� � Pe�mit #-�,.� _ � � � � ^ , _ - _ , _ � - 21. Bucts; inStrtuture7 •� '• ^ -+ r _ = =� �� 70. TJnderglc'_vo�i N�dro � 22. Duct� Ver�til�fing � r �. ;.] y ':�:; 77. ProduoL �iping �` sas li Oii 23. Gas PFpe•Rougki & Tdsc � * : � -.�1 � - '+ J s� � . � , �p'� T 8 � � � . e. Undergrrr� �d F��ysll ,. � 24. Roof�framin .. n '� _ _. -. : � .p -� - ,� - . � 9 :. r R � �.73; Undergrr�d.Storpc��,rTank;�Gas ❑Oii 25. Roof:-6healhing .�. r y� '� �� 7q; Overhead Hydr3? � ` � 26. 7}Bar:Ceil;ng (Svuctural! & Mbr�.'o�oat F -� '� , � t 75r Dry Chemical � � � �� Y' - 27. Frarne anth Piashing f j r; Y s' •� •x K 76. Dry Stan�pipe ��^' .� - ='=- _ _ r -28. Lathmg&Sidin9 ' � -- =' ��' �� 7T-., FIXEDSYSTci�iNA�. � , �,;;.; 'ti:, �-� �:. - '29. Insulation� : � _ �• � � r 7� FIRE PAEV. F(N�L .. �� ^ �' - ' _ - � 30. Drywail N�ilin9 .�. � � - �� c � ,'� :.�I�AITb{DEP�'.�EQVIREMEiJT = - `� � � 31. Plaster Brown Coat . - . . � � �t 79 FINAL IpSPECT[�N -' ' 32. cJectrical`how,t hAetF�r�"ripal ; � ' � �;� � SO:c FOOD CERTIPtCATE 1�`SkJER: - - � � 33. �inai:Eleej�ic � r� � - : ' i ` Notes: � �i - • - _ _ - � !F .� -, - -34. Fjna+�ieating&AirConditioninQ�� !` y ` �. _ - 4 - � . - . 35. Final Gas'�ipe Yest �; . %d� �_ �F _ � .� J ,. ' - - � • ..� : = 36. �ood'ror CanoPY } � � ' _ _ .c i '� - g � � `. _ . (,. ' 37. Final.Pactory FirePlace^ :; � � ' �f , - e . .. f� a 38: Final'Plumbing _ t � 3 ��7' (p' � - - , - � �r r 39. Water'Service�F�nal _a r " -� , yj; ' _ � ' , " � - '�40. Gas Servicz-Final •� : ^: <� _ � 'a � !•. _ � .;, , . . - s =�i... . � ix .,�g ' . r � r �p � -41. Solar pomestirFinal; '� , -' << ,T , � - � � 42. Backfiow�.Preventer � + . - ? - _ - �� . _ �. . _ - 43. Backflow'irrig�tion � } - - ;. . 5 " � ' . . �. . . 44. Landscape Irrlt�ation System � � � r � � J � -i '-J" � ' �� - � " - _ , _ 45� 3ound AUenuation _ ; . ` ` r - ,- _ . '`= � _ 4fi. Handicap�Regalations " ? � - _ _ - _ ` � � < - 47. FINAL STRUCTURE & BUILDING � _ . -, " �� . _ 48. FINAIPLANNING � -- ' - � - - ' ' , 49.. Electric Release to E�ison �_ � � �� ; - ' ' _ � 50. Gas Release to Southern Califor'ia Gas Co � � � ' _ - _ - ' ` - ; ; ' ' ' 51; CERTIFICATE OF OCCUPANCY ' � • ' - - - . No. Date �uuxessa euuoca: �anairsw�eRiwohr: • �ooxess MVL.IUIITi01DDNE$$: NiCNREtTOR QlITlffJI: 1NCX.ON FNR3100RF55: uc xo: coxm�aars w�: cam�croas�uimo �noxess: uc. w_ uur: Yci2MTI' NG: r ub5v37 PLAN CHtCii NU: uh1f,'i-�7 iv „ iR'Jt ft il' � 1' 1(' 1t k 1t 1t Yt i1' 1t 1! 1�' YE Yt Yf'I! Y! ft � lt 1F %!'%t 1t 1�'/! 1t ft 1t iR fF 1F � lf 1t'R'h'�t'%t"1!'H' jl' 1F iF R Yt R K%t Y! iR R'A 1t 1�"M1' IF 1! h Y1' R iF i! N' YY k'lY'IY Y� fC A' J! i!'A"R l YYE QTY li E S C h i i% T I G N ON.i i ��i:; � �'ti"iAi, �t)S i uxr: PLCI FLU uMr: tJCENSED CONTflACTORS OECLIN�TION: I hmetr/ dlim uds pnNy d yapvy tlet I em IEmaeE ivda pom'vu d Cheqs 9 (mmmemvq W� Sacibn 10001 af Gv'¢un J d tlro Bufinea aN Pmlmtiau COEe. utl mY bCwW u in lu0 bmw atd Mtetl. CRY IJC. NO.: L1Q CUSS: LIG NO.: Dele: CoMmtlw: OWNER BUILOEfl UECL�N�TION: I he'eby df�m uMm pa�Wy W perjury Iha1 I am ezemq Imm iM Cauemon liwn+e Lew la tlr INbw+q �uaon (Sepun )W IS Bwiwaa eM Rdafioro Cade: AM ctY a mumY xf� reGuim e De�! lo mmLW. NW. unporo. demdoh, a repei erry �I�uctwe. pv io b eauence, ebo nawm iM xpqlrsM la auch perm� to Na a v{pied elmamxC ihtl M a aAe �� liemed W�� lo �M pronmu d rtr CONretlm Liceme law �GMps 9(mmmendnp wilh Satlnn 1000) d Divuian 3 d tlr uvimv vd Prdeaiom Godal n ihet M a kro u uem7 thaehwn vN �he beme la ihe dbY� ss«nq'vi. Niy vidmion d Seeion .031.5 Ey enY aDW� lor e pertM Mpee tM eppliceM to e tivil penelry d nal mae Ihen Me IwndnE EOAua j550D�. � I.maw+wrollheP��i'amyempbyeeewlhwegeaeslheiedammpenatim.willEotMwwk.andlMabuclurebM'uilendad w oflered la eele (Seclbn'lOCC. Busi�roee eM Proleeaiw�aCotle: The Conlradan licenva Lawdoea mlepplyto en ownad popary wla Wids a inwm'ae �Mreon. eM xM doee euch work himeeX a Mnatl a Mruqh he a her orm emWnl�+. Wo+� �MI euch imqaemeMa ara m� inteMeE a dlaed la eeb. tl, Mwever, tM buitli�q a inpnremma u add wEhin ar yaer d canpblion. Ne owmr-0uader v.ill Mw IM buNen d pvn�p he a eha did m� buN a impwe la iha purpma d vbl. � I. m oxmr G iM YWMY. em mdvwdY mrureeM wVh 4anwd conbenm m mmvuu Ne qN� (Setlion IOM. Bw'vnwa md PMeas'vie Code: TM Can�retlon lianee law Aom �wl WdY b en owner W pW�Y wM bo'Ide a intta'a �larson ud xfio convecb la wtl� P�qas wM a aNredMe) li�srued Wnuw io �M Canomwa liorue lew'1. � I em uemq uMer Seciion: 8. b P.C., br We reason: Dele: ��: I da hamby cslity Ihtl I em ewere W eM wMacierd Ma nquiremama d Celloma Hmth vd Selery CoEa Setlime 95505.25.53�. enE Y553a, ud Nm I a eiry Mun dul&iq arvpent vnll / wil m� (ercb aw) meE to camply wih eeid pme mdn eM ihs npwamrvs br e Cam� laconavucfonu iroEifretianhamthe�r�anepen�eni Oietrid. Revde�aiel m�mMion MO�ioroenmemqhan iMss poviaions. Dele: AGdicem: WONKEN'S COMPEN4ITION DECLAFATION: I hereby elfi�m uMer penelry d perjury aw cl tM bllowirq dadartliom: ❑ I hare uM wil meinten e unilicele d wneent io eellimure M wakere' canpenaetion. ea provideE fa by Setlim 9]00 d iM leba Cada, la tM perlorme�e ol iM xwk la which ihie pamG ie ovueE. ❑ I hew ud xil meimen waYas' cvmD�ion imurence. m nW'neA h' Seaian 3'roo d Na lsbor CoCe. br Ihe M��^�'a d iM wak la whiN I�u pemi� e esued. My waken' mmpemmun imurerce unier end pofiry numEr ere: Ceiner. Pol'ry Number. iie sxvion need nat 6s rompbleC i(M permd is M we hwCred Cdbrs (SI001 a bss.) �] I cenh' �hm in ihe peAamance d tM wak /w wfikh Ihis permit ie iawed. I ehell mt employ eny pneon in eny manner m u to eecane sudw �o me wo�xen comw�io� �.. d cr��e. �e eare. �nm u i.nwb n�o� wqm io me won�.• co,,,ven,mon w�o�. a s.aan a�ao d ine leee, wde. �.nd� �onn.un mmoh •mn ma. pow.ioro. Dve: MdceN: Wem4rp: Fellun b ucun woM�n' mmpxwtlon cw�rap� I� unMrM, ��ul Ntll ubJ�cl en wmyloysr fo <rlm�nl pwltlu aM elvll flnu �.q b om �uitlred f/quaxd JO/Nn (fiP0,P001, M atldltlon b IM eo�f ol nmp�ru�tbM1 tlamq�s� u provMW br In 9setlon 9]O6 0l IM LeborCOW, /nMa4 ��e ettomsy'� lsu. CONSTNUCTION LENDINO AGENCY: I hereby elfirm under pendry W paryury thm there ia e oonsirvd'wn bMirp epa�wry /v Ne con�� w m..� r« wnia� mc ro�� m e•�ee (seao� x��. c�. q. LENDEN'S NMIE: . LENOEP'S ADDXE55: I ceMy tAm I lwa neJ Nb epykNim vd ams �lul Ne ebo+e iAormelion u mrtea. I qpee to awnply Mnh M r'nyerd munh oM'vienme arM eiele kxa reklvp to Euik'vp mm4Wbn ud Mreby eutlw¢a iepiaeen�e4ves d Iho rnyb enter upon iM abwe-meNionstl popery �o, ��.,,d� �.�..,. Dma: Sp�tun d Ovrtrd/Wen✓RVP�✓��reerc (5151-18.WP) Whilo-Buikiq85alary:OreerFFb:Cenery-Appium:Rnk-Rmenue:Oddanm�Maemr 1 GAS 5"r.kvlC�. 6,"IS 1 SEWEit, i:tiNNLCi'[i�N Tii dUILL1N� r'ACI! 22.GG LNir Or FEGS P�r s � . __._. __._. D , ,: .; � CITY OF COSTA MESA 6.'i5 "I.L.QG . � CC.VSTRUCTION AND PLANNING � POOL 'A tiPPROVALS Permit# Date Inspector AppROVALS Permit�- Date Iin:pector r 7, Ter;DorarY Elec[rical Service or Pote 52. Pooi & Equipment Location 2. Soil Pipe�Undrgrnd. � 53. Steel Reinforcement 3. Electrical Conduit Utility-Undrgmd. 54. Forms . 4. Electrical Conduit�Undrgmd. 55. Electrical Bonding 5. Steel Reinforcement 56. Rough Plumbing & Pressure Test 6. Electrical UFER Gmd. 57. APPROVAI TO COVEft�GUNITE Z Footings 58. Electricai Conduit�Undrgrnd. 8. Foundation 59. Gas Pipe, O Undrgrnd., Test 9. Water Pipe-Undrgrnd. 60. Backwash Lines, P-Trap, O Undrgrnd. 10. Strucmral Floor Syscem 61. APPROVAL TO DECK 1 i. Property Sewer Line & House Connection 62. Backwash & Receptor-Final 72. Sewer Cap 63. Heater & Vent-Pinai � 13. floof Drains 64. Plumbing System - Fina� 14, Rou9h Plumbing 65. Electricat-Final . 75. Rough Electriwl-Conduit 66. Solar SVstem-Finat 16. Rough Electric Wiring 67. Fencinq & Access ApProval . 17. Rough Wiring Sign . 68. APPROVED FOR PLASTERING 18. Rough Electrica6T Bar Ceilin9 �� 69. POOL/5PA SYSTEMS-FINAL 19T Rough H¢atln� & Air Conditioning FIRE DEPT. REQUIREMENT 20;.Rriugh�actar Fireplace APPROVALS•� Permit# 21`:- Ducts, in Structure 70. Underground Hydro 22r D�"Ms, Ventilatinq 71. Product Piping (� Gas ❑ Oil 23 •Gas Pipe�ftough & Test 72. Underground Flush 24 Ro,of Framirig� 73. Undergmd. Storage Tank a Gas Q Oil 25. Roof Sheathing 74. Overhead Hydro 26�T-6ar C�ilir�p ($trucwraq & Monocoat 75. Dry Chemical � 27� Prame and �IaShing 76. Dry Standpipe 28. Lathing &�iding 77. FIXED SYSTEPA FINAL ,_ 29. Insulati6n •' _� 78. FIRE PREV. FINAL 30. DrYwal('Nai�rir� HEALTH DEPT. REQUIREMENT I 31. Plas:er Brown-Coat 79. FINAL INSPECTION 32. El�ctrical Pow.er Meter�Final S0. FOOD CERTIFICATE ISSUED 33�Finai Eteceric- a Notes: � 34 PinalHeating�,AirConditioning �- r 35�yFiqal Gas PipevTest _ 36:=Haod or Canoriy� 37-Firaai Factory�iceplace � - 38., Finaf Plumbing , 39�Wa'ter Service�Final - - 40: Gas Service-Pinal . 41:'So�ar pomestic-final 42 =8ackfiow Preventer 43. Backflow Irrigetion � � 44. Landscape Irrit�ation SYstem 45. Sound Attenuation � � 46� Handicap Regulations 47:�FINAL STRUCTURE & BUILDING 48. FINALPLANNING � ' 49, Electric-Pelease to Edison � ' 50. Gas Release to �Southem Califomia Gas Co ' 51. CERTIFICATE OF OCCUPANCY No._ Date �Oonsssaew�mn: '3�%J L15� Si u�: I:.ITY VF' l:QSY'A ML•�SA — UOA�IJ'li:Mt� L�I.itiM:l9' N/NEp811mEIFpqNN: hirivf'Grii HTS iitiii i't1iM Mti: M 'v+3Sv59 ��+� LS"v'1 iir.;,l'CL1rr' � N.i3. 9[66G ' � i>EiiMiT N�: M vd5G54 r7,AN CiiEi:A Nii: iv ��V'i: N Sui'r�: N APPL.MAIfMO�DONESL CiiTi;iY'hi7Cili:�tv TYrt: V—N t�tRMI'i TYFr.: Miii: e�iiiiPUS'r.: Ni;ir .xcxneaon�m�n Guiiii:iS cNGiNci:iilNi: n acx on �a�s �ooxEss: 4 4 v V (: AM!'�US Uft N.B. ca�m�craasru� i�Ai:TF:ii: i;kANL CONSi carn�croas�uiwo 1�V1 Wt:SII:LIYF � �= v uxr: CA 92b6"v i'i14)b31-"7433 �noxeu: N. b. lA uc. ra: %� 4 9 b 4 �JLbbV wrt: LUV LICENSEU CONTN�CTORS OECUX�TION: I Aweb/ eSrm uMs prWy d pwjW Ntl 1�n frwM �Mr pmvwu d CAvqw Y (mmmandn0 xit� Seciion ]000) d Dn'vun � W Ne &ivineo aM Prafxa'vu COEe. end mY 4m�w u in NA /au eM Nlatl. cmuc.No.:G'iv1I8 �C.ClA59: L1C.N0.: />4 64 E:3iP: Vb/9fi �, ��,� �,�. OWN BNLDEP DEC4P4TON: 1 hreby tlfimi �vMr pruly N perjvy tlW I am mmmp hwn Ur Can�eCm liwms lew Iw IAs lo p na+On (SWion ]W 1.5 &niqta ettl PNaedms Cods: MyW a advtly wtiidi iap�utu e patmG lo mmbutY. etler.'vnprv.a. d'eh, n ryer mry �buclurs. p'v b n evu�w, e6o �uYn the applmN la aiN pami to Ae s apned petemM tlut M a�M ', 4m�ued w�� o Ne a�� a ur wrcrem. lio.n. le. l�qs s(�«�a wn saann 1000) a o'rreim a d �ro uaimv vM Rofmum Codel a IAm M a dw o uemq iherehan end iM Eem b tln ^E^peE uamqian. Mrv vioWian d Sspion . W 1.5 Eq uy epplraiu In a per�rd abjeC� �hs �ppfraN to e uN paWly d m� mm Nen (ha hvWetl Aolen �SSOOp. � I.mownrdiheO�WhYunH�dq'MwihwapesmiMi�abmm0�.wiTEoOrwnkeMNevWu�em�'vurMeE adlereEM mb (SecUon 10u. BvsMn eM Pminaore Cade: TM Cauratlm Liwme lew does nolroNYloan owmr W prapeny Wc ddd+s inPa+thmem. md Mo Eom wrn wh!'vnwL a MnN a Wu9h M1e a her own amOb/w. pa'� �hr aM 'unpv.emema ua mi iiumded a a11eaE la ub. tl. Mvwer. iM GONi'p a inpaamem u wtl w'vkn ar Y� d mmpWion. Ne e.�,.,a�aa« w ne.4 in. wroa, a�c n. o, w da �w n�aa «�wa. i« u» ww�• a m.�. ❑ I. n wnw d tM PW�Y. em u3m�wlY mtletl^0 rM fwnnE mbaebn m mmud Qr pNb (5ad'vi )DII. &siws W Pmlmiaa Code: TM Cauemm liwoe Law dou nal epM' b en ovmer d MW�Y who NUW a'unpv+a iheraan utl Mo eamreeb br iud� V�4�+ w0� e mvemM�) 6ee'mA P� �o tM Caaema� L'mw lew�. � 1 em ssemq uMr Swtian: B. 8 P.t.. b tlu nasm: Dete: Oww I do henM urlM tMl I am ewara W eM uWnend rtw npiummero d Cellwirie Ileellh eM SddY Gode SW'va 25505.155]J. eM YSSJ�. md tlw I a m J M�s dold'm0 � w9l w0 m� (vcle ar) nesd b canON ri1N uk tltl� mEu mM �M rpWran�rL br aDa�lorcaavuciionamodif tionhdniMlv e�y empenrm0utrie.Psuds�elmmwioneDGK�umenuemqhomtMe pwisans. ome: �oo4.b: WOflKEN'S COYVp19ATON DECLAF�TION: I herab/ Mmi ukx paWly d ps�uy ans al IM lobwinp Mtlmmbm: ❑ inm.d,aw�.:a.:�.�.w�.wo�,«vio..e:�.i«.md.•oo�.w++o�...awwero,nre.c�a�aowm.i.eo, coe.. �a m. w�ommrc. a w.en �« w:n w w�m v �u.a. .I�l �n.,4enewm.:e.�wkw.�mnv��.m�ws.abna�ooam.t�bO.wa.b.u»pA«�wb.am. 7� wak Ip whidi Ne GMti "s oueE. MY �wrlan' wmM�+dian'vrinenc� arir md D�Y numbr rr c� 5�'A'1 r" FUNu EXFIR�:S ver.,,rc�w, ��'4T�72TuuTeSeees G4i3G/98 An eeaion iwd na es m�ryM.d r w c�+�t u rar a» hn2.e amua R�ml o. wJ �] I cenh Nm m ths vMmnuica d tM wF ror which �M w� u uwnE. I Nel ia �nW W enY Od� N erry mennar w n �o beemw ubpi to tM welws' mipe�muion Mw� d CaNmi�, md ypw IM J 1 4vM peeonr wibjW �o �M xeM1an' emazion P'sioro Swion �100 d �ha lebv LOM. I disY lo xq� mm0 ytlwe P�. /1 P e1s: MV«:7^��Z . (l-'/ ' W nY: F�Yw� ro wNn �o'tw��'rn�W„�rtlon nm'�rq� Is uWr�0. W Ntll �WNc� �n �rro��n ro cihYM W�p uM u niw w ro a� �une�.e wuaw eol/in ft�u4wnA m tllltbn m tln cwt ol conp�rwWn � u P`oHtlrtl ror In Sxtlm JIOB ol IM L�Eor COLr, IMw�s4 ��m�✓� �M+ ONSTq11CTON LENpNQ �OENCT: I lraby df udr paxly d perjry IM Nea u� amprvCion bn6np eprwry b Ne oe,�om�eMe a m. wan w. wda w o.+N � e..e �swun �. c:. cl. LENDEF'3 N41E , LENOER'S AODFE53: I cenity IMt I lieve meE Nu appcation eM nnu �Mt IM ebwe'viamdion e mrtq. I apiw lo cwnply x'nA e0 cy aM cpmly ad'vw�we vd stm.laxw mM�q u dddiq mmvudian md AsW aWw¢e nP�� a iFu a'aY m xa« w� Na ebaa�mMiarE p�oparry la irepatlbn qvpmea. , kONALU lie:i;kANu � S /�-Q o.,,�%p��9/ —% SgreWn W OmMlpwu/ a (St5ta8.WP) WhGr&ddnp85day: Q JGH U�.SCRIPTiON : 22v9SF �INi;LE FAMILY" R�STIi. �8'i51� �AiiAi�i: �Q r i: CLA3M VALOE: CA'(.i:•-VALOE: i,iiGUi� Vi:�:: Fi••:s i i:VMMENTS: REF:H-8�G71 "GA1iBAGE LISF�iiSAL" if iFii ii ii ii ii±f ie iF ie ieit ii wii'sF ii if i'r ii i'e ie iF ii ii ii ii tif iF ii ii ie'sF've ie iF ii i+iF ii iF iF i'r i'r�ii� if ii ie i'r ir ie iF iF if ie ir�w'r-ii� ii i4 w�w a� ;'r w� ie ww'viie i'r i'r iF if ii x ii 'L u N I N G k 6 jj 0:i R ii M E N"i 5 5 B'1' b A C K 5 -------------- MAIN bUiilliNi; --------•---- ------ ACCESSiikY tfUJ.LL1Nli ""' "' _'.__ FRNT: t�'Y" TN kEHft; E'T IN FRNT: FL i:N 'rcEAii; c'i Yiv L�F7: F'1' IN AGN'C: r1 IN LEF'T: Ei IN iti;ii'i; r"f Itv PAIiKIN� AEQ: PkiiV: PAkCEL: OUOiiG��ii i;NE: it'r:F N�: Pi.I1NNINi� Ni�TE5> i iF iiiF iF ii �k it ii ii ve've iF ii if iF ie w ii it'rf ii if ii if ii ii w if w ii iF if iF ii'ri ie if ie ii ii ie ii # if ii if w iF if i'r ie if ie+f ii i'r �k li-�rt'vi �w if w ie i'r ir ir ii�w �X��k �i. w� if ir i"r i'r ie if L �. V E L O Y M E N 1' S E k V I C r: 5 R F. Q U T li F M i�. N f 5 �GNINi; AF'YtiVV�:L c3Y i�qTii: uUILuING AYYRGYeli nY' : liN'i'r.; � _"_j�� A�'F'L1iATIGN ISSiiEu ifY: �LC�� unit: j/O� ii'rfii'vFifififie'veieifie'sFiftifitiF'vi'se'sFifit xwx sex Rxw �wsrxsrw'�i' ..+r+'xstwse�rfiiFiewifieir+r'viii�;eiew��r �w�xx� �ri'r� LE�AL'i ZA"f ION : N F F. E 5 U M M i ti Y 5'i kUC i U1tAL 5r.'GM�:N'i : N BLU� FM7 PLUMBiNi; ELBCTi2iC MiCIlAN:iC E'Ti2r: SM:i!'ifiE� GR�1u.iNG r �RM I'1' 49."I.S %5r S M I i• i NON -•it �i5 PLAN LS�D�. NEi 22.uG BUIL'LING-uIG-> F�r'RML'f I55UE rLAN-CHI:CK fi�'iAL i�AZi� liuii 'f�i1'AL5----> 48.iS 22.G"v G.OG '7G."lS 'I"v.i5 .`v"v R�:VENUE LIV.iSIGN 'iOl'ALS--> COLLECft1i: "7G."l5 OVr'R/s(I�RI': .u"v bLUG PM1' FLUM83Ni; EI.EC7'NTC M�CF(i1NlC 1�3:1iE SM.CP/i01' GitAulNi; r�;AiV-�i:HE�K 7"v.25 Yt It f 1t 1! lt'R 1! 1f R 1F'R �-IF'R!F 1F 1�'A ft fF a!'IF jt ft'R 1I j!'R'i{ A 1� 1t K�F lt lf'It lt x 1t 1f iR ]A'1� � jl"R R 1t Ll' A•'%t i! 1F'�t Rl�'h 1F R R A T"A' T' il' %t A' it' �A' A' Yt'R 9Y T' R w l� I N L" t V I L U A L r' t e: G't't E A ii ii O W N TYr'c Mr.0 MEC N tC MEC tir:� SjiY L E 5 � ii i P T I O N Uiv.L'i �ii5i 1 tNST r"GRC—AIRiGiiAti FOkN <= 1"v"v ri dtu 13.�5 1 i'ACfiiRY f IhtFLACfi 9, S'v 1 INS'1' I�t:ri�L iviuUCTS F'E:u BY Mri 'r.',XHA�iS i �. SO 1 tik:N1'ILA'i ION rAN CiiNN Iu S iNGLr uii�:T 6. SG 1 EACii AYPL Nu'C iN i�THER i:A" UK�.:-''E� �. Sv EIVL V . �:a � " OCT 0 81997 �, , C�TY OF COSTA MESA �l V�.l lil. l: V:i 1 13.'tS �.SV 7 . J l% b.7V 9.SV .� COjlSTRUCTION AND PLANNiNG POOL 'A � � _ , ( Date Inspector Date ,Inspector ' RPPROVALS Perm�t # APPROVALS Permit # 1. Tert;porary Electrical Service or Pole 52. Pool & Equipment Locat�on 2. Soil Pipe�Undrgrnd. j� � .� 53. Steel Reinforcement � 3: ElectricaV�Condu�rUii{ity-Undrgrnd. 54. Forms -�4: Electrical Canduityn8rgrnd. 55. Electrical Bonding -5: Steel Reinforcement 56. Rouqh Plumbing & Pressure Test '6: Electrical UfER�Gind. 57. APPROVAL TO COVEfl�GUNiTE '2' Footings _� ; - 58. Electrical Conduit+Undrgrnd. $ Foundatigt ; � 59. Gas Pipe, � Urtdrgmd., Test �, 9. Water Pive�Undi�md. j 60. Backwash Liner, P,Trap, O Undigrnd. 10. Structural FloorSvstem 81. APPROVA�T6qECK 71. Property Sewer LinG& HouseConnection 62. Backwash & Receptor-Final 12. Sewer Cap ' y . 63. Heater & Vent•Final 13. fioot Drains -. 64. Plumbinc� System � Final 14. Rough Plumbing- *• 65. ElectricabFinal � ' 15. Rough Electrica�Corxiwt -- 66. Solar SYstem-Final 16. Rough Electric �9iri�g � � ' 67. Fencing & Acca�s ApProva� 77. Rough Wiring S�gn - j 68. APPROVED F�R PLASTERING 18. Rough Elettric3l:T Bar Ceiling 69. POOL/SPA SYSTEMS FINAL � 79: Rough Heating & Ai« CondiiioninQ _ ry . .,, Fl,4iE QEPT.AEQUIREMENT _ `_ 20. �ough Fa¢toc� Fi��lace _ � = � ; 5 - � G � APPF3�,OV�1Lfi= _ P �ey'mit # � - � K- 21. Duc�,.s, in Striist�r�' � ' •• ^ � � - = = "+' 70. YJnderfr'our�il Ft�dro � ,F S � '�n 22. Butts, Ventila'sing.j � �,j ,� � y � .' ;;, 71, Product i?iping ��as C Oi� 23. �ias P�pe•Rougn & TAst �; ., T f: t. 7Y, Undergro�r�d PtLsh � � 24. �oof'PraT�ng" � r ' �� - , ' � � u 73j Undergrnd. Stor� "�n Tank O Gas � Oil � 25. RooE-fihc8thing � F C �' = � '� 74. Overhead Hydro � F : 26. j�-Bat'Ceiling (5tnRtf�rall & Md�o�oat f_ " - � 7� Dry Cheqiical ,- • - 27. ��ama and Flashing � - - s T � ' 76. Dry Stapc�{nPe , � :: � .`; - � -'2L - .:: ^ 28. Lathing &'Siding ; ' _ _ - �� '�� ' � 77� FIXED $lt.$TE,�ii�INAL � � ' 29. Insulatiort' i� � s • � I � 7� FIqE PREV. FI '- L �- 4 • - � 30. Drywall Nailing y r., ;� �� -l�AlTk! DEP�. f�EQZ1IREMEM� , _.: � 31. Ptaster Brown"Coat7 + : �- ^ � ' 79, FINAL INSAECTIaN • ' - ' � 1 y � 32. E'lectrical pow�r M1Ret�rfiqal �'� � � 80.'; FOO� CERTIFI�ATE ISSiJEd _ " � � t � 33. FinabElect��t� * � � Notes: '.' � _ ' - _ ^ 34. FjnaFHeatin9&A��ondftroniriqs r f � � r � -� � , - � � . 35. Final Gas�ipaTesi ; _ .: i� - � c . � - � � e - � ' 36. Hood"or CanoPY �' � • _ . '. , I r . 1 _ ; . • � - � ` ,, � � i 3�. Final.Factory F�repiace : -. -. � � - � 38. Fioa��umhing _ J _ ; � je� = . - - �. ' : - � 39. Water Serv.ice-Finai ' ' � ! I. , � ` . ,. . - 40. Gas Servfce-Final . • - •I•. - - ' � - - - I - • ' 41. Solar pomestlrFinal` ` � " i - ' .� - , ' � : - _ 42. Backflow Preventer . � •. f � - - - � � S � ♦ 43. Batkflow Irrigation , ' ' r � � _ � • - 44' Landscape Irri2�ation�System '" - � - � - --' � ' - ' ' • ' 4 45. Sound Atienudtion ,� ~ � c 46. Handicap�Regvlations � ' 47. FINAL STRUCTUR� & BUILDING � _ 48. FINAL PLANNING ' -� - � 49. Electric Release to Edison , 50. Gas Release to Souchem Califomia Gas Co 51. CERTIFICATE OF OCCUPANCY � Oate "i � i i (ooxEssaeuiowa 379 21ST ST oxxe�rsruYeivaiarx: NEWPORT HEIGHTS TWO .ow�ss 1501 WESTCLIFF �t260 ' ' NEWPORT BEACH,CA 92660 631-7433 �rv�. muwa �noeesx ARCXRECf OR FNOPlFFA: JICN.OR EN4.'4 AODPES4: camunanx.uEPACIFIC GRAND CONST. cam�crorca�utva 1501 WESTCLIFF �� N.B. CA 92660 UCENSED COMP�C70fl4 DECLAX�TION: I Areby Nim �vWr prWy N pxryry thu ��«a�v .�n s«ed, �000� w orv:� a a me a�:,so .�a Ra...�. coe...oa � cm uc. No.:0i1011$ uc. cuss: uc. No.: 7 3 4 9 uHr: uc w: UNT: (714)631-7433 „�,p, 734964 uM: 260 irw.e wax po.moeu a Gnep« 9 �e b in M Iwu and ansa. 7 EXP: 06/I?8�) Dme: S� Camenar. OWNEP BU DER OE� LAN1i10N: I IwaOy Jfum ivdx psWy W p�jvy �IW I em axenq hom tM Canree l'xwa Lew la Ns IoOowiq rwm (�� 15 B�mm md Rdudmf CoEs: Nry r1y a mutly Mitl� �pivm e puml lo ausTC. eEx. npwa. demd'eh, a repv mry �wdua. prior b u eauuca. tlro npmx IM appGmN la adi pamC �o Ns e eqW ee�rroe0 tlW M a�M io.,xe w�ww m me a�au a m. caureaas uoe�aa �e. Ftiq« e I�a+m+a .an sea�m �000l d oi.eon a a �ro ._esT,luemea erd Ratwuro COCaI a ihtl M a dr u ammq �herlvn ud tM ba'v tar tlr �MpeA mamqion. MY vioW ian d Swian ''>oai s M�v eook.m i« e v.�+ •4�+�ne wd' a+ w e da v�r d mi maa uvn e.ro Ix�sd eows �55oop. � I,mowwdlMpopertyamyrnpb�as��.IhwepesnNs�oMmmpsuetion,w9EotMxaF.rtllMWucnasero�vaaMeE a alle�ad tor eele (SxLm )ou.8usvawvd Prolmdun Code: TAe Cavrwae liesua lewAou m+GM/Ioen ownerd o�weM Mn WNa a inpaa ilweon. end Mn Gom wN wk lenw! a Mntl a tlrau� h'v a Mr wm eroM�. pa+� �het arJi im0��+rs M ivadsA a a1Md la ub. O. Iwwx. Ur dddiq a inpwamM e�old wuAvn ar Yw d mmObin. Ns oxw-0uiNa xi0 Mva IM MVMn d pa'vp M a tlr Nd nd ddd a"unpas la Ne pvpme d Wal. ❑ �.., o.n. a m. aoV.n..m..am�.�r ma�er,:a .Mi srro.e m�tredon ro oumuu m. w9w+ls.eion ]a.. a�.ins..na Pmtmmm COCe: TM Catlretlm lraw leM dom nd VMV m en oww d pWNY Mc deld� a'vnpw'u 1lw�san and who mwecu lar wd� n4�s wh e mNraew(�14rn�C w+�+b �M Gwv�aGw� lium� lew�. � I em uemq wMa Section: B. a P.C.. br Nu �won: Oele: �� I do I+roby unEY Met I em ewua d W ivWnWd tln ipivernru d Calimue IMeth rd SMY COAe Swbro 25505. 25SV, eM 25SL. uM Nel I a m/ Mun dnlEeq omryeM WI / wil ml (drtb ons) roM b candV wM1 uid me aodn vd �M �ap�uremwro br aD��InmvmrmnamoECretionhwntM�43u�miysir�Omrie.RwEraW mmt�unioneppfre�iauenvamqlmnthwa wwmoru. om.: �oo�w+: W ONKER'S COMVENS�TION DECIAN�TION: I MrWy aAmn utla prully W pajiry an� d IM blbw'vq dedebom: ❑ 1 hsw W wJ msiruen e cenJ'ctls d oaueni to �Nli�wn br Morkri mnparomion. n pwNM Iv Dy 6Wion �)00 d �M lebor Cods. l« �M OMamuc� a tla xvk In w4'rJi Nu D�V u mutl. ' n I hm aM wil me'vuen wka�' mmpmqion'umuuo. n nipnW by Satlbn J100 d tlw leba Code. br iM pslamuKv d IM 1C" wark i« �MiN ihu oxmil u's�uM. W vvkan' mmpanwian Muerca w�ir W w=Y number ve: �,,,;,,; STATE FUND EXPIRES rw:v M,mw,: � 0 4/ 3 0/ 9 8 1m ..a�o, n..e mr e. oomv�, w a«m� e ra n» nunmsn eotlu. mool n w...) �] I centy OW in Na pMmnvice d tM wak la .Mic� IM prmC u mueE. I NeY nd ars�qq erry pa�on in vry mennx o n �o n.mm. wM.a m m wonen� cano�� m.n a ceNan:.. w m�.e mm I�l.Mw exmr wdw �o �ne woncas� tompenW o V'e' • G SW ion �)00 d IM leba Cod�. I qW rk� aampy U� pwi��.� Date: ApqiW: � Wemlrp: F� un b� cun woM1w�' mmp1nutlon covwp� l� un/nrlul, uM �IWI rbJc/ �n xrpleyw ro cNmVW pwltlu �ntl Clvll fln�� up b em ��nOrM fMuuM OolMn (SIPD,aooA ��Itlan ro M� rost ol romowwlbrt tlernp� �� provlEW br In Ssctlm J]P6 0/ tln laOOI Cob, IMxu4 ��mW i Iw. CONSiNUCT10N LENpNO �DENCY: I Mraby atfrm unEer pendy W pmjury Ilm �Mn i� e conqNpion bMiiq parcy br iM paAumeMe W �M xak h xfiidi ihe M�^t u's�uad (Sadion �OB]. Cw. CI. . IEN�ER'S NAME: I � LENOEWS �DDFE93: 1 cenih IIW I hera red the eppliutian W atle ihd M ebw�'vdanwion a oonw.l yna �o oomply Mnh eAay eM couMy adineMe� vM nete levn ialmYq to btildvq cmw�rLm antl Mraby euUv¢e �w��+� W �liu dly bwa uD� �M ebwa�mwuned papeny ��'°'tl�°��D'�'RONALD LEGAAND �� Dms: 1�9� Sgfaturo d QnetlApwN rmu �, (5151dfi.WP) WMa-&�ddip8SalMy:G�wmFJa:Gwry-�ppiwu:RnkJimwn:OddmvoE-/u�aun CITY OF COSTA MESA - BUILDING PERMZT PERMIT NO: M 086702 PLAN CHECK N0: N CONSTRUCTION TYPE: PERMIT TYPE: MEC � d ��1 PERM NO: M 086702 GOVT; N SUPP: Y PURPOSE: ADD SOB DESCRIPTZON : CONVERT 1555F GAAAGE AREA TO BONUS ROOM SQ FT: CLAIM ��ALUE: CALC-VALUE; GROUP OCC: R-3 / COMMENTS: CONVERT PART OF GARAGE AREA TO 1555F BONUS ROOM, tIH86699 �+�*+�*****+�**�**��r �*�*+��**+��+�+r��*+�**+�****�*+��*�+r�c+��+�+��*+�**�+�*��***�*�**+��r�**� Z O N I N G R E Q U I R E M E N T S S E T B A C K S ------------ MAIN BUILDING ---------- --------- ACCESSORY BUILDING --------- FRNT: FT IN REAR: FT IN FRNT: FT IN REAR: FT IN LEFT: FT IN RGHT: FT IN LEFT: FT IN RGHT: FT IN PARKING REQ: PROV: PARCEL: 42623228 ZNE: REF NO: PLANNING NOTES> i iF'it iF iF jt ik jt it iE iE it jE ik iF 3F dt it 3f 3f iE if 1E 3k it it it if if it 3f iEi6 jE iF iE iF iE 3k if 1f IE 3E iE 3E iE 3E if iE 3E iE �1t 9E 3E 3E it jF �E 7f iE �t iE ic iF iE ji 3E iE if 3E ik iE iE it dt 3f it if aF * ; D E V E L O P M E N T S E R V-I C E S R E Q U I R E M E N T S •l �ZONING APPROVED BY DATE: BiI�ILDZNG APPROVED BY : � DATE: �PPLICATION ISSUED BY: ' DATE: � Z2 � if iE 1E iF iE 1E ih 1F 1f 3E iF iE iE 1F ik iF if if iE iE iE �f iFiF3F3fifiFiFiFiFiFiF3F�FiFiF�F3F3f3FifiiiF �f 'iF'iFif7F3F�fiFiFif iE 1F iE iF iE iE �E �1E �E 3f iE LEGALIZATION:N F E E S U M M A R Y STRUCTURAL SEGMENT:N BLDG PMT PLUMbING ELECTRIC MECHANIC FIRE SMIP/RES GRADING PERMIT 12.25 25R SMZP/NON-RES PLAN ISSOE FEE 6.50 bUILDING-DIV-> PERMIT ISSUE PLAN-CHECK TOTAL PAID DUE TOTALS----> 12.25 6.50 0.00 18.75 18.75 ,00 REVENUE DIVISION TOTALS--> COLLECTED: 18,75 OVER/SHORT: ,00 HLDG PMT PLUMHING ELECTRIC MECHANIC FIRE SMIP/TOT GRADZNG PLAN-CHECK 10.75 !E ik if fE iE �E !E if aE if !f �1t iE 9E af k if if iE iE �k 1E iE if !F 9E iE 1Elf fk if iE iE if 7f iE aEli 1t 1f ik if iE if if 16lF iE if if k if 1f if 1f �E if 1E i� �)f ik iE i4 iE i4 iF iE iF iE ik iE iF if if i! 1E 1! if ih I N D I V Z D U A L F E E H R E A K D O W N TYPE QTY D E S C R I P T I O N UNIT COST TOTAL COST MEC 1 REPAIR/ALT HEATING UNIT/SYS W/CNTLS 12.25 12.25 END OF FEES 81-22-1998/18:53 NM/f18.75 RCPTfl:B1-8818566 PERMIT:086792 I 0 ' CONSTRUCTION AND PLANNING � APPROVALS Permit # 1. Temporary Electrical Service or Po"le 2. Soil Pipe-Undrgrnd. 3. Electrical Conduit Utility-Undr§rnd. i 4. Etectrical Conduit�U�drgrnd. 5. Steel Reinfo�cement 6. Electrical UFER Grnd. 7. Footings 8. Foundation 9. Water Pipe•Undrgrnd. 10. Structural Floor SYstem 11 . Property Sewer Line & House Connection 12.'Sewer Cap % �•� 13. Roof Drains , 14.'Rough Plumbing 15. Rough Electrical-Conduit �'. � 76. RoughElectricWiring ' 17. Rough Wiring Sign ; ',�` 18. Rough Eiectrical•T Ba� Celling 19. Rough Heating & Air Conditioning 20. Rough Factoey Fireplace 21. Dutts, in Strutture 22. Ducts, Ventilating 23. Gas Pipe•Rough & Test 24. Foof Framing 25. Roof Sheathing 26. T•Bar Ceiiing (Strutturall & Monocoat 27. Frame and Flashing 28. Lathing & Siding 29. Insulatipn 30. Drywall Nailing 31. Plaster Brown Coat 32. Electriwl Power Meter�Final 33. Final Electric � � Final Heating & Air Conditioning 35. Final Gas Pipe-Test 36. Hood or Canopy 37. Finai Factory Fireplace 38. Final Plumbing 39. Water Service-Final 40. Gas Service-Final 41. Solar pomestic-Final 42. Backflow Preventer 43. Backflow Irrigation 44. Landscape Irrigation System 45. Sound Attenuation 46. Handicap Regulacions 47. FINAL STRUCTURE & BUILDING 48. FINALPlANN1NG 49. Electric Release to Edison 50. Gas Release to Southern California Gas Co 51. CERTIFICATE OF OCCUPANCY Da[e Date Inspector POO L PA , APPROVALS Permit yIE Date�- �. Inspector 52. Pool & Equipment Locatio�- 53. Steel Reinforcement 54. Forms . - 55. Electrical Bonding 56. Rough Plum6ing & Press�re Test 57. APPROVAL TO COVER•GUNITE 58. Eleccricat Conduit•Undrgrnd. 59. Gas Pipe, O Undrgrnd., Test 60. Backwash Lines, P•Trap, � Undrgrnd. 67. APPROVAL TO DECK 62. Backwash & Receptor-Final 63. Heater & Vent•Final r 64. Plumbing SY5tem • Final � 65. Electricai•Final � 66. Solar SYstem•Final 67. Fenciny & Access APprovai 68. APPROVED FOR PLASTERING 69. POOL/SPA SYSTEMS FINAL ' FIRE DEPT. REQUIREMENT APPROVALS Permit # 70. Underground Hydro 71. ProductPipingOGas ❑Oii 72. Underground Flush 73. Undergr�d. Storage Tank O Gas ❑ Oil 74. Overhead Hydro 75. Ory Chemica� 76. Dry Standpipe 77. FIXED SYSTEM FINAL 78. FIRE PREV. FINAL HEALTH DEPT. REDUIREMENT 79. FINAL INSPECTION 80. FOOD CER7IFICATE ISSUED Notes: . `J 5 M _.� ; � . Y : '; :.y ewim+o: �/ y L 1 S 1 5 1 irroux*+: NEWPORT HTS TWO dDDRE4A 1501 WESTCLIFF N,B. 92660 wr�. Muuwo woness: u�cxrtecr on ��n: MCN. OP FW.'S AWFE54: ca+mecrarax�ue: PACIFIC GRAND CONST. CONfiIACTOR4YNIW0 1501 WESTCLIFF �o��sx N . B . CA urR: uc ra_ UNT: (714)631-7433 ,x�: 734964 92660 �M, 260 110ENSED CONfP�CTOHS DECWiATON: I Meaby ellim under pa'uly d pwpm/ Nq I am 4mssd wder pariviav A GMpw 9 (mmmendn0 wvhs�yp� 'l000 Oivaion 3 d Na &�ama entl P�dm�'vu CCEs. and mY 4ama e m M1A lace end slled. cmuc.No.: // // uc.cuss: uc.No.: 734964 EXP; /J Ome: Camreaa:�%Gw�'�( � � �—.�-r./l /F4 EN BUILOEN DECL�FATION: I M�eby el! �vder pauly d prjiry �Mt I em evmq hom tM Caaieaaa l'rrua lew In tlr Idbwiq �eefm (5etlian ]OJ1.5 &nicaa md Rdwbnt CaEs: MYW o wuNy xltith rNu'um e V�md lo canhucl. etlx. inVo.a. demd'vA, a rpei arry avucwre, p'v m u eauvrw. abo repitim IM epplimm Ia wcA paniw io fib e qprd vtlansq tlW M a�M '� lioemed pum��en� Io the pwmwv d Mr COMredm Limme lew �CMqr 9(ovnm�q wuh Seeun ]000) d Div'sian � d �M usnw eM Prdmiom Codel a Ihel he a ehe u eaamp thrshom uM 1M bmu lor Ihe eAepeE memqion. My vidmun at braion I0�1.5 by eiry eppliunl lw a permn subpea the eppliceM to e tivl penelry d ml mas �han fxs hwdred dopars j$,50p��. ❑ I.aeownerdlhepropenyarmyempbyeaewlhwepeaavlheiwlammpeneelion,willJOlMv.ork,eMiMel�uclurew�wlinlaWeE or oilared Iw esle (Seclion 10as, Busnma end Prolesaiona Cade: The Conlreclon Licanaa lew daee mt epplyto en ownwd pmpeny wM10 Wide a inD� �hereon, eM who doea euch woA Mmeell or henetl w �hrouph he a her own emplv�em. prwked tIW wch impovemmU ere rd intaMed ar aflereE la eele. II, however. IM Witliip w inpovemeM is wld xilhm ww yeer d mmplelbn, Ne ow�ror-0uiltler wiil �ero IM Wrdm W yoviip M a ehe dN mi buitl a improva lor iM W�s d eeb). ❑ L e. �., a ine ww«n. �%��*N ��rec�ro �•:�n iim,.ee conirecw. a conaw ina wdsa �secon �a.. 9udn...ne Prdamon� Coh: TM Comrmaa Licems Lew Aoee nal xODN �o en oxw d popMy xfio buJds a mWa'x �liaaan end who COn�lBCb W WYI ptOqKl! wM a Wn�ta']d�v) ICMMd Wnuenl lo IM C.OI1�fBd01f llGtllw lAw). � I em uemq uedr Section: B. 8 P.C.. tar Nn ieeeon: Dme: Owwr: I tlo IwnW ttnM Net I em ewere rt aM uMenterd Un roG��ws M CaOanu IImEh W 6eIwY COAe Seaime?5505.2S53J. eM t5531. xd thet I a enY hnun dukmB � xiG / wa M(e�cb on�) naad b mmNY wih uid �s mdee and tM �Ww�oros b . v� �«wmwnian v nneirmion han�n. �:�m�ns� Dinria. n.,N«um mmnwion wo��+m. e..�+�a rmn m«. Dale: AppfceN: WORKEH'S COMFENS�TION DECLARATION: I Mreby elfim� uMer pereM1y d pejury aw d iM b0owi�p dedara�iom: � i nw..m �;� ��. �.n�rme a oom�i io..n:mw. ro,.dw«.• oomo��..+a� r« M smm a�oo a m. ieea. Code. la tM parlmrienca d the xvk la wNch Ne pemv� u inued. � IheweMxilmeiwnwaYae'comV�uniiuu�uim.nnW'vsdMSwion7lWtl0eleborCada.brtMG��W�W�M .��«»n�a,mAo.mmes.�,Oe.Mr.a�+' S�'�1��i�.mw4r�.,mn..�.: EXPIRES c�« vaKv N�m�,: 0 4/ 3 0/ 9 8 hia eection neeJ na be comWeleC f tMG�x u M wre nurrdred CWkre /3�Oo1 w bse.J �] I cenAy Ih� in Ihe pMormence d tha wah br whch Ihie perm� Ie iewed, I ehell iwl employ any perem in ury menner n u lo become euEjeG Io iM workeri compenation lewe d CdNwnie, enC eQrea IMI H I ehauk become wbjetl to IM vro�Imis' eanpeemtan qw'u' �na d eeun 3)00 W ihe Lebar COEe. I eMll IophWiih mmpy law povWons // iv zi/ ii ma. �/ Md�va: 7� !� �.i.�.�i�/ i • Ip: F�N�n b ueun woikeri mmqrwtlon eor�rp� Is unNwNl, uM �fWI �/�ef �n ulplqr b nlMirl pwftlq uW flnu ,p ro orH MnEistl tlpwerd EW4n (S10q000A ��Ifbn ro tl�� cwI ol rorrpuuetbM1 Lemup� u proHEW br In S�cHm 9]O6 0l tlr� LMorCOAi, /rrtxw4 �d ettomsY's /sss. CONSTRUCl10N LENDINO AOENCY: I haeby etF'm unCer penMy d per''vy ihet ihse u a canp�utlion brdi�p apaicy br Ne pMormerce M IM xoA Irc w}tidi th's pami u uwad (Swun 3091, Crv. C�. LENDEN'S NIW E LQIOEP'S ADDHE55: � CM�h' �� 16M 1084 �IO B[�fd4A� BIY� 6L1011W I�N 9�1G NiMNllpl O CqIKI. �,TM �0 C0111V�Y M1N�1 BO mY 6fY� NIIItlY OIdC14K1! erd etme kxe nlm�q to drildn0 mvtrumon eM MreEy aNMeae �WA�mi.w d�lie tl1Yb eMa uo� Ihe eEwe-mmtlioneE qapery 1IXin9pBtl1Oop°`°°'°' RONALD LEGRAND Dme: (StStiB.WP) Whne-Buildeq85dety:0�eeo-Fle: ery-ApDy�:Rnk-Revanue;DOlEenmFAneeaor CITY OF COSTA MESA - B�ILDING PERMIT PERM NO: B 08913 PERMIT NO: B 084138 PLAN CHECK NO: N GOVT: N SUPP: N CONSTRUCTION TYPE: V-N PERMIT TYPE: STR PURPOSE: NEW JOB DESCRIPTION : DEMOLISH EXISTING APARTMENT HUILDGS SQ FT; 22,000 CLAIM VALUE: 22,000.00 CALC-VALUE: 22,000,00 GROUP OCC: R-3 / COMMENTS: AND A 1 EXIST. BARN **+r****�t*�r*x��**x�*x�x��r******�r�r***�t�rx�rt*x�**x�*x�**�t�r*�*a�x��rr*+�i�+�x�******�*�**+r-x�+r***��r* Z O N I N G R E Q U I R E M E N T S S E T B A C K S ------------ MAIN BUILDING ---------- --------- ACCESSORY BUILDING --------- FRNT; FT IN REAR: FT IN FRNT: FT IN REAR; FT IN LEFT: FT IN RGHT: FT IN LEFT: FT IN RGHT: FT IN PARKING REQ: PROV: PARCEL: 00000000 ZNE: REF NO: PLANNING NOTES> �,� � M �f �F iF iE iE 1f iF �E fF if 1! it 1E if 1E ik if !f 1! it ik ik 1f 1F 1k fk 1f iF ik it iE ik �E iF iE iE �f ik if if !E if if * i! �f iE iE iE fE ff �F �E iF if fE fE fE fk �E �f �f k iF iE if iE if !E iF �k �f iE �F it i! if fE D E V E L O P M E N T S E R V I C E S R E Q U I R E M E N'T S ZONING APPROVED BY DATE; " BUILDING APPROVED HY : DATE: � APPLICATION ISSUED BY: � DATE: �� 1f1k1F'k�EiEiElFihitiElhitiE�Eif�('ikMilitiF�F��FiF��F iFi�{f'�i 7f7fiFiF{fiF�3F{F'lfifiEifiEiElfiFiF lfif LEGALIZATION:N F E E S U M M A R Y STRUCTURAL SEGMENT:Y BLDG PMT PLUMBING ELECTRIC MECHANlC FIRE SMIP/RES GRADING PERMIT 312.25 2.20 SMIP/NON-RES PLAN ISSUE FEE HUILDING-DIV-> PERMIT ISSUE PLAN-CHECK TOTAL PAID DUE TOTALS----> 314.45 0.00 0.00 314.45 314.45 .00 REVENUE DZVISION TOTALS--> COLLECTED; 314.45 OVER/SHORT: ,00 HLDG PMT PLUMHING ELECTRIC MECHANIC FIRE SMIP/TOT GRADING PLAN-CHECR 312.25 '1.20 !! k iF iF iF if iF iF iF k if ik if ik if if iE i43f if if !F 1F ik �F iF �k if 1f iF ik if if iE 1f 1F fE �! �f iF if i! if if 1k �! M 1f �k if �Flf iE if iE if if if �k iE iE �E if if �E iE �E iFlf fF �! 1! if jf �k ik ft ik 1f I N D I V I D U A L F E E B R E A K D O W N TYPE QTY D E S C R I P T I O N UNIT COST TOTAL COST SFR 22000 DEMOLISH BY VALUE RESIDENT. NOZONE 1.00 22,000.00 END OF FEES 08-I1-1997/02:21 P�/f314.45 kCPTH:�l-0010552 PERMIT:084138 i" CONSTRUCTION ANO PLANNING� POOL 'A ''• •`' APPROVALS Psrmit # Date I�spector qppROVALS Permit # � Date Inspector �. 1. Temporary Electrical Service or Pole 52. Pooi & Equipment Location 2. Soil Pipe�Undrgrnd. 53. Steel Reinforcement 3. Electricai Conduit Utility-Undrgmd. 54. Forms 4. Electrical Conduit�Undrgrnd. 55. Electrical Bonding 5. Steei Reinforcement 56. Rough Plumbing & Pressure Test 6. Electrical UFER G�nd. 57. APPROVAL TO COVER�GUNITE 7. Fooungs -� � 58. Electrical Conduit�Undrgmcl. 8. Foundation 59. Gas Pipe�, O Undrgrnd., Test 9. Water Pipe-Undrgrnd. _ 60. Backwa:h Lines, P�Trap, � Undrgrnd. � 10. Str uctural Floor Svstem . 61. APP RO V A L TO D EC K 11. Property Sewer Li�e & House.Connection 62. Backwash & Receptor-Finai 72. Sewer Cap 63. Heater & Vent-Final 13. Roof Drains 64. Plumbing System - Final t4. Rough Plumbing 65. Electrical�Finai 15. Rough Electricai-Gonduit . � 66. Solar SVstem�Final 16. Rough Electric Wirin9 67. Fencing & Access.Approval ' 17. Rough Wiring Si5� ' � 68. APPROVED FOR PLASTER�NG 18. Rough Electrical-7 Bar Ceilinq � 69. POOL/SPA SYSTEMS FINAL � ' 19. Rough Heating & Air Conditioning FIRE DEPT. REQUIREMENT 20. Rough Factory Fiteplace • • APPROVALS Permit #` ' 21. Ducts, in Structura � ... - - � 70. Underground Hydro 22. Ducts, Ventilating. - � � _ 71. Product Piping Ofias OOiI 23. Gas Pipe-Rough &�Yest '. , � 72. Underground Flush 24. Roaf Framing • ' 73. Undergrnd. Storage Tank � Gas OOiI 25. Roof,Sheathing � •� . .i � � .� 74. Overhead Hydro 26. T-Bar Ceiling (Structurai) & Monocoat � � � 75�. Dry Chemical 27. Frame and Flashing; ,, _ � 76. Dry StandpiPe � , 28. Lathing & Siding - '- • 77�. FIXED SYSTEM FINA1 - 29. Insulation �� ' „ . 78. FIRE PREV. FINAL � 30. Orywall Naiiing � - HEALTH DEPT. REQUIREN7ENT 31. Plaster Brown Coa:: � ' 79. FINALiNSPECTION .- - 32. Electriwl'Power Meter�Final - 80. FOOD CERTIFICATE ISSUED 33. Finaf Eleciric ' � Notes: � 34. Final Heating�& Air Conditioning -: � . .• 35. Final Gas Pipe�Test : : � . , � _ . 36. Hood or Canopy - �� ." .� 37. Final'Factory FirePlace ' � � � � 38. Final Plumbing . . � '- � 39. Water Service�Final � • � ' . • ' . � 40. Gas Service-Pinal - - - �� 41. Solar pomestirFinai � • ' � 42. Backflow Preventer • � . , -43. Backflow Irrigation; " ' ; 44. Landscape Irripation System " . , � • � � . _ • � - 45. Sound Attenuation ' - x :- • • � , - . 46. Handicap,Regulations ' ' � �� . 47. PINAL STfiUCTURE & BUI'LDING S'�N Ct'� �� 48. FINAL PLANNING . ' . 49�. Elearic Release to Edison -�- " 50. Gas Reiease to Souihern California Gas Co � " 51. CERTIFICATE OF OCCUPANCY , . No. Date �ooAEssaeu�m'c: 319 21ST ST urn: CI'TY UF COSTA MESA - bUILGING FERMIT OWNEfiSN.WEIFqqMk NEWPGkT HTS TWO FERM N0: GRA 089bY. �p� 1501 WESTCLIFF N,R. 92bb0 FERMIT NO: GRA 089621 PLAN CHECK Nt�: 02263-97 A GOVT: N SUFP: N �vri. wna+a .00�sc �� 9400�CAMPUSEURING urcx. oe e++�•s �oowess: N.H. �� YACIFIC GRAND CONST. ��u� 1501 WESTCLIFF .00�ss: N . B . 92obG IN: I �eraby eAkm uMer pei 9 d IM Budma arM Pmle cuss: uc. ,x ra, 0 uxr: CA 92n60 ' (719)631-7933 CA ��, 7399ti4 urir: 2 ti 0 r Nei l em licaneed uMx pamiom d Chepm e vd mY licenae b in lull bm vd eHq. 4964 E3iP: 06/58 � Dne: � CaNratla: � OWNEH ILDEN �U CLAR TION: I hereby alfirm uMer penely d perN'Y � � I em exemq /rom tM ConVeclae licanee lew la Me .iyl�a� rm.� Iseaion �oais euenm..�d aroiw.iom code: nm av a �v which reau�ree e ro�nn io cm.o-ua. Mm. �mwa+. demol'ah, or npeir any sVucluro, p'v io es bwence, ebo reyuiree iM appl'rant In suc� pemie to fib e eproE eletameM ihet M a sM licensed W�� lo iM povivma d tM Contredore liroroe law ICheqer 9(comma�np wuh Saqion ]OW) d Oivebn ] W IFr ,cvwa enE Fdesa'vm Codel a tMl M a ehe o vemq Ihaehan e�M IM bnte Ia Ne eYeO� mem0�on. MY vide�ion al Setlion NJ1.5 by emy epplirant I« e permil eubpd+the eppliram to e rnJ pauM1y d ml mas Ihen fxe hundreC dd4n �5500�). ❑ i. m ow�. wme aoaenr n mr empm+.•,.m weae+ee m.:.w. mmw�mion. �;n ao me wo�k. end m..wa��e w �a �ie�d.a wdlereJlaeeb�Seclim]01�,Buvm�eentl PmleenioneCotle:TheCaMretlonlioeroelewaoee�epplyloenownmdpmpe�ly who buida a inqrnm tMreon. aM xM does suM wak Nmeell or Mner a Nrouph he «her own ompb�ees. povdeG �hq euch imP�mmv ere nd inieMM v a11sW la ub. tl. howawr. �M bwltlirq u inpownav o wtl wM1lun ar Y� d wmWMian. tM owner-0uJda W hm iAa EuNm M O�w�^Y he a eM did m� duN a'vnpv.e la iM W�a d etlel. ❑ �... a.,�« a ine uwan. �^ ^�a,w.v �ureano wn uron..e mw.da. m m�ow na pq.a (sa,o� rou. a,.va...�e Pmtevbm Coda: Tha Cauemon lirome law Eom nol e0M'/ b en ows d G�wNY v,fio ddds a vnpa'w �Araan vd Ma wnvens la aM pmptla v.nh e mxreqor(s) Icaewd Wnuam io �M Conlretlar� Liane law). � I am e�emq wder Sx�ion: B. 8 P C.. br Nb iemm�: Dma: Owtw: I Eo Iw�eM unM tlw I em ewero M eM iMenWd �As iaVN��sW M CaUaw IbNh vM Sa1elY Cods Setlbre 25505. tSSV. end 25534. eM Nel I a mry Mive buikiiq omryem wll / wil �wl (ticb one) neeA io canpy wYh eeid mme mdr enE �Ir nQ�nmb W e D�n I«mrei�union a moERKalionhomiMA'r'iiwTy .l�erepemem Oimria. Reeidanliel aonalruaion ePPiu�imsanexemqtmm Neee ��. W ONKEN'S COYVpI3�TON DECWUTION: I MraEy el(mn uMr pauly d psWry ar d tln bbw'vp drfum'vw: � I heva e�d xil meintew e cerlJ'rele W wwni to seMimun Iw xwkere' canperiWion, n prorideE la by SWim �100 d tM LeEa COM. la iM pe�lormence d tM xwk la wlich �hie permn u muad. �] � ne�e d,e :e meimei�.wnnn• canw�� ... i.awrea W swion a�ao a ub �m« coe.. �ar me w�a� a m. wpk Iw xhidi Nia pxmit n mued. MY warFen' mmqneqion "wumnc@ �.m ��mw, m.: EX P I R ES c�«: _lf��it.__ruiv_-__ Pd'ryNumber: �� 09/30/98 ,,rs axtron nnee � be romd.ree � Ms pemix ia ror me hu�died ed�.i. Isrrol a �w.) � I cenAy thel in ihe pe�iwmenm d �he work Iw whch �hie parmX ie iaued, I ehell m� empby eny penon in any manner eo o to ome subjae io iM wrkere' compenaetion lewe d Cdilomu, 6/egree Ilat il I ehouk become wbjW b IM Mwkan' mpevelbn D�aion d beeion 3]00 d IM Lebor COM. I ehell 1�Mil mmpy wnn ino e pw�eioro. �a: �oa�: Weml p: HUun ro �xun roMnri rompxu�tlon rovsrep� ls unl antl �IWI �u6Hcf an s�vloyx ro cNMml pm�ltlu uW Nvl 'nu up ro aw hintlM tMuaand rbllen lStOG,P00A ��l n ro tM ewf ol romps�uetbM1 tlunps' u provhNC bi In tlon J106 0l Ms LaSorCOW, Infxut, mtl ertomry'i I.u. CONSTFUCiION LENqNO �6ENCY: I hxeEy elfum uMs penely d pnj.vy �het ihme o a conq�uqion Wd'up yricy br tM pmi«mence d tAe wuk ta xAirh �he D�i u uwsd (5enian Jo8). GH. CI. LENDER'S NAYE LENDEWS �DDNE%: f*i•. WAne-Buikip 8 Selery: O�em-Fb: Ce�wy-App5ram: Rnk-Ra�ue: GoWenro�Mamaor CUNS'IRUCTIUN TYPE: V-N PERMIT TYPE: GRA PURPVSE: NEW JOB DESCRIPTIGN : GkAuING FUR 6 F[aMILY RESIL. SQ FT: CLAIM VALUE: CALC-VALUE: GROUP uCC: R-3 / COMMENTS: X ie�kjiieieiFieii�iFiEiFiEiciEiEiei'r-w�ifiEii�Ei'r<ifii�iiiiii�ieiEiEiiiEiEic�ki't�ki�iii'riEiEifiEiE�lEicirri'r.iiicEiEk�Ei"riEiEi"riiieiiticiiiEjEieiFieiiieiEiesFii Z O N I N G R E� 0 I R E M£ N T 5 S E T B A C K S ------------ MAIN BUILuING ---------- -------- ACCESSORY BUILUING --------- FRNT: FT IN REAR: FT IN FRNT: FT ZN REAR: FT IN LEFT: FT IN kGHT: FT IN LEFT: FT IN kGHT; FT IN PARKING REQ: PkOV: PARCEL: u00G0U0G ZNE: REF NG: PLANNING NOTES> {,,� i 'Jt �l' jf Jt � i!' �t jt' jt jt'If lt l�' lt �' iE �t')t"x' l! ]t'R %"R i[ )f �t j! if jf �t'If'1!Y! lf lt jl' 9l' �"It'!t ft jt ff'lt lF'%f l!'R lf 1f'i�' lf i! :f'/t it 9f')f if'k ff'It ]�"�'R'IE "�t 9f S("R i!'R * 9c 9�"k jt'Ic U E V E L G P I✓i E N T S E k V I C E S R E Q U I k E M E N�T S ZUNING APPkOVEU bz D:vTE: �y SUZLDING APPRGt%ED BY : TION ISSUED BY: LEGALZZATION:N F E E S U M M A R Y BLDG PMT F�LDMbING ELECTRI� NiECHANIC PERMIT DATE: ' , 7 LATE: � � / iEiF�kxiiiiic3fifnx vezx x +eiEii� STRUCTURAL SEGMENI':N FIRE SMIP/RES GkiiLZNG 126.00 SMIP/NON-kES PLAN 7.SG ISSUE FEE bUILDING-DIV-� FERMIT ISSUE PLyN-CHECK I'OTAL PAIU LUE TOTALS----> 126,GG 0,00 7.50 133.5"v 133.SG ."vG REVENUE LIVISIUN TVTALS--� Cc�LLECTED: 12b.00 OVER/SHORT: .GO BLUG PMT PLUMbING ELECTRIC MECHANIC FIkE SMIP/TOT GkADING PLAN-CHECF( 12b.00 iE iE ic're+c'rE iE �iE ii if if if 'rE ir i'r iE je'r'r if if if ii ir it iF iF rf iE ie ii ii �it i! if ii� ih 31� if dE iE iE iE ii iF ir i! iP it ii�'rf ie iE i'-i� it �ik �iE it i! it if ie iF if iE iE it �if if ii� iF if it iE i'r ie ii� ir iE I N U I V I D U A L F E E B k E A K L G W N TYPE QTY L E S C R I P T I O N UNIT CGST TGTAL CUST Nu FEES WERE SELECTED FGR TAIS PERMIT 09-39-1997/02:42 Pfl/£126.Qtf PEf2p9I TPT084621 CONSTRUCTION ANDPLANNING POOI PA APPROVALS Permit # Da;e Inspector AppROVALS Permit # Date inspector i. Temporary-Electrical Serviceor Pote 52. Pooi & Equipment Location � ' 2. Soit Pipe�Undrgrnd. 53. Steef Reiniorcement 3. Electrical Conduit Utility-Undrgrnd. 54. For'ms 4. Electrical Conduit�Undrgrnd. . 55. Electrical Bonding 5. Steel ReinPorcement 56. Rough Plumbing & Pressure Test 6. Electrical UPER Gmd. 57. APPflOVAL TO COVER�GUNITE 7. Footings 58. Electrical Conduit-Undrgrnd. 8. Foundatio� ' 59. Gas Pipe, � Undrgrnd., Tes[ 9. Water Pipe-Undrgrnd. 60. Backwash Lines, P�Trap, O Undrgrnd. 10. Structurat Fioor System 61. APPROVAL TO DECK 1 t. Property Sewer Line & 4ouse Connection . 62. Backwash & Receptor•Final 72. Sewer Cap 63. Heater & Vent-Final 13. Roof Drains 64. Plumbing System � Final ' 14. Rough Plumbing 65. Electrica��Final . ' 15. Fough Electrical-Conduit 66. Solar SYstem-Final . i6. Rough Electric Wiring 67. Fencing & Access Approval � 17. Rough Wiring Sign f>g, AppqOVED FOR PLASTERING 18. Rough EleGtrical-T Bar Ceiling 69. P00 VSPA SYSTEMS FINAL � 79. Rough Heating & Air Condi;ioning FIRE �EPT. REQUIREMENT 20. Rough Factory Fireplace APPROVALS Permit # 21. Ducts, in Structure 70. Underground Hydro 22. Duas, Ventilating 71. Product Piping O Gas ❑ Oil 23. Gas Pipe�Raugh & Tesc 72. UndergrounA Flush 24. Roof Fram�ng 73. Undergmd.S[orageTank OGas OOii 25. iioof Sheathing 74. Overhead Hydro 26. T-Bar Ceiling (Structuraq & Monocoat 75. Dry Chemical 27. Frame and Flashing 76. Dry Standpipe 28. �athing & Siding 77. FIXED SYSTEM FINAL 29. Insulation 78. FIRE PREV. FINAL 30. Drywall Nailing HEALTH DEPT. REQUIREMENT 31. Plaster Brown Coat 79. FINAL INSPECTION 32. Electrical Power Meter-Final 80. F000 CERTIFICATE ISSUEO 33. Final Electric Notes: 34. Final Heat�ng & Air Conditioning - 35. Final Gas PiPe�Test 36. Hood or Csnopy 37. Final Factprv Flreplace . 38. Final Plumbing 39. Water Service-Final � 40. Gas Service-Final 41. Solar pomesiic-Final 42. Backflow Preventer 43. Backflow Irrigation 44. Landscape ��ripation System 45. Sound Attenuation 46. Handicap Regulations 47. FINALSTRUCTURE&BUILDING ��.�...Rg /+_� � (�f(iQi- 48,. FINAL PLANNING � 49. Electric Release to Edison - � � 50. Gas Release to Southern California Gas Co 51, CERTIPICATE OF OCCUPANCY , . . No. Oate FINAL GRA�ING CERTIFICA'I'ION �roj�c naaress: 3� 7— S�7 2/ -� Lat Number: T�P?�% / S 5% 6� [-vis /— 6 Permit Number: � ivA ��f 6 21 By Civi! Engineer: I certify to thc satisfactory completion of grading in accordanre a�ith the approved plans, spxifications, local and state codes. A11 drainage devices required by the grading permit, grading plan and grdding ordinance have been installed. Adequate provisions have been made for dreinage of surfacc water from each building site. The minimums are: 296 Fall from structures within S feet from exterior walls. I`,6 Fall for asphalt surfaces and landscaped areas. 0.596 Fall for Concrote surfaces to approved disposal areas. The final monuments as shown on the reco�ded tract map were set. AI� final grading eleva- tions are within t 1/10 of the�esigne� elev2tions. Supervising Civil No. 375�� Da�e / - 9/1 ST7�� ' and SIQ�1 �ro MAA.25 '90 (WED) 12:57 COMMUNICATION No:26 PAGE.2 ., AOOPESS OG BUILqNG: �%�J 21 � T � T axrhxswweiviwmvN: NEWPORT HTS 11 .00xess; 1501 WERSTCLIFF N.H. CA 92bti0 MPI. IWIINC 1DOXESS UNT; nxcxnecroa�+r+�n: C.J. ATFCINSON uc.r�o.: 54U55 u¢x.oxu+c.•s,�ooxess: 1501 WESTCLIFF ��; N.&. CA 92660 cor+m�cTarsxexE: r'ACIFIC GRAND CONST. (714)631-7433 COIRNRCTORSMYIWO 1501 WESTCLIFF ,�p� N.R. CA „G„p, 734964 92660 ��, 260 LICENSEU CONTflACTOqS DECLAFATION: I hereby M'rm uMm panetly ot peejury Ihet 1 em liceneed uMer proviviona d Cheqm B (coTmercnp �tilh Seclion ]000) d Oiwun 9 of tlie Buainea eM VMeeeqru COJB. eM TY lim'ue n in IWI faca vM aHetl. c uc.No.: �c.cuss: uc.No.: 73496 .../// EXP• D e: � Conhetlor: C' 1..�.�.�-�/� � a^--- O NEfl BIIILDEH OECUINITIO{ I hereE elfi under per�ely d pmjlry tl� I am exemq Imm iM CoMrotlaa Limnse Lew la IM � w+q ieeaon (SeGion ]03t.5 9us'vwss eM Pm/eeaiona Cade: nnv eA' a mumY �fiid� rtWirea a Geemn m mutrua. Mer.'vnYme. moloh, a repa'a eny avuciure, priar b �a ecuerce, elao�iequiree iM appliunt lor auch pem�il to fila e eginE sletematl Nel M a ehe IicenaeE W 9�a�� o �he provisions d ihe Canveaore Licenae law �Chepbr 9(mmmenc�q wnh Secton ]000) d Orvbbn 9 d Ihe �uaneea ene Prdesaure coael «�nd ne « Me o e.emq �na<nan ene �n. esvo e« uie elbpeE e.emqon. Mr �almion d sw:m lWt.S by enY WW�t fa e permu subjxls �M epd� to a aril panelty d ml mae Ihen fxe hurdrad doAva �5500�. � I. m oxnar W IM popeM or mY �W%'� �� waB� ea thei wla eompeneetbn. will do tlre xwk. vM Ne aweturo u ew imeMaE or Mered lor eele (Senion 1044, Businpa end Prolessiana COEe: TheContreewa Lioanae lewEoae �wl epON �o ��erd praq,ly wM10 budde or'vn0�a� ��^^• �'"� � e�ch'xork himaeM m henet a Ihraph hu a har oxn emplo�ese, povidad thm euch impwamanta ere nol inteMad « WmaE /or aab. tl. haweuer. the huJdiiq w mpowmem'v eold vmh"m ar Yeer d mmWe�ion. tha owo««c�aaa..�n n� ina w� a wa��e na «� eb � aeb «�mw� �« ms wmo� a.w�. � I. as owner ol the qopaM. ��duervdy mmreuinp wnh liwnsed wnvec�an ro conweua Me pmjaU (Saeion 101�. Bwi�wen enE profesmone Cade: The Contreeloee Lieeme law daea na eppy to en owmr d papeny vAw buike a imqovee iMraon erd who canvana lor ach prqeda wvh e mMreGor(a) Ikeved punuani io �ha Conlradon Lianee lewl. ❑ I em examq uMaz Senion: ✓• B.;BP.C., tar Nia raman: Dete: �a I tlo Mreby cMtly Nel I em exare d erd uMasbM iM1a reQuiremmb d Celfanie Heeph eM Selery Goda Sadian 25505. 255�3. end 255�a, eM Mm I a enY �ure WiNiip om�pant will / wil ml (�b anl need to canply wYh eek pete codes enE �M'epuimmena lur epaimitlamnsvunonormodifiralbnhomiMAi u�i-liiy.erepemsmDiatnq.Reaidamielmnarueoneppira�ianeroevamphantheea provisiona. Dete: �pd�: W OflKEN'S COMPENSATION UECLARATION: I Mroby e1Nm uMer peneliy d per'ryry me d tM blbxinp Eetluelura: ❑ IlieveaMwJmeimenecatificeledmmamiovaXinwnforxdke�c'cwnpamUbn.uprovidedtabySeaion3)OOdiMLabar eoee. �a m. o�«mwe<a m...oek t« wlien ina w� m u,�d. �] I hew eM xil meintan wwken' mnpemetion inaurure. m rpuimd by Seqbn 3lW d the lebor Coda.lor �M perlamuics d iM woA Im wliich ihie parme ia'vauad. My waken i� er eM pdi�y number ere: ��,;,,. �"0P'.5'i� `r�`iSR�i _ _ EXPIRES PdiryNumber. J 09/30/98 ,Tis sectian rreed nw be mmplefed i tM permt u M wie hundred dollem Rr001 a len.) � I cenily Net in tM pe�lamarice ol �ha wwk tor whch the permN is iasueE, I ehell nd empby eny pereon in ury menner eo n to i e wbpa ta iM xvrkera' camqnae�ion lewe d CelAamia erM pree Uw tl I MwW becoma wbjerJ m �M vwken' peNetion v�+ oro a 5eam a]oo d ine tec« coee. � enen ton � nn com W wun th p�v�mwn' �� Dele: . Applicenl: � I'�� am/nD� Fellun N ueuro wo en'ro tlon rovsnps Is vnkwN( ene �IWI �u6/�cf en employer to Mcrr rW pm�ltlw vM dv�i mra w ro wr. nuw nouxM ew n(ifoq000A ��Irbn ro m. co.r ol rorrpsiwWn, eamsp� u prormM ror m Sxtlon �]06 0! ths LeDor Coh, Inten�l, en0 ettomsy i Ir�. CONSTNUCl10N LENDIN� AGENCY: I hereby elfirm uMer peneXy d per'ryry ihel iMre a a conatrudian bMuq epercy br iM perlpmaMa d iM xak br whidi the pertni is eauad (Seaon �091. Civ. C�. LENDEN'S NRME: LENOEH'S ADDRE55: I ceniN �het I heve reed thb eOWicetbn eM ame ihei tlie ebove inlamelbn is caned. I e9me io camdY wi�h ell dry eM oounb adire�aw 91M BI81B Idw81d0��1p �O WiYJvq CMS1Yqicn vd hefBb/ 9UIhClQB Ilpf69Bn�NNM Of �hu aly lo eNx upM �M BbWB.Tl111YMIM ptOpBl�y `°`�°'0°tl�""°°°°` RONALD LEGRAND !— nn � oa.: CITY' OF CUSTA MESA - bUILUING F+EkMIT PERMIT NO: B 084336 YLAN CHECK NO: 0339b-97 L � lS b OSS PERM DIO: H U8933E GOVT: N SUPP: N CONSTRUCTION TYFE: PERMIT TYPE: STR PURPOSE: CON JOB DESCRIPTION : CONST. 427LF HLOCK WALL & 337' REIiTINING SQ FT: 7b9 CLAIM VALUE: 22,GOO.OG CALC-VALUE: 28,700.00 GROUP OCC: R-3 / COMMENTS: 427LF BLOCK WALL & 337LF RETAINING WALL *****�**r�*************+��*�*�r*****�**�*��***�c*+�*��***n******��*�c*�*�+��**�� Z O N I N G R E Q U I R E M E N T S S E T b A C K S ------------ MAIN BUILDING ---------- --------- ACCESSORY BUILDING --------- FRNT: FT IN REAR: FT IN FRNT: FT IN REAR: FT IN LEFT: FT IN RGHT: FT IN LEFT: FT IN RGHT: FT IN PARKING REQ: PROV: PARCEL: 92623228 ZNE: R2MD REF NO: PLANNING NOTES> 370 LF OF 6' HIGH BLOCK WALL + 115 LF OF 6'-8' HIGH �(+PART > RETAINING) WALL ALONG REAR; 6 280 LF OF 6' + 2' RET. WALL iE 3E it ik �E dE iF it jk 3f iE if if ik dF if iE iF ik iE iE 3k ik if iE iE i(' iE 3h i! if iE ih il� �f 3F 3f df iE d! iElE iE iE 3F 9h 1E if 3F iFiE iEiE if 3E iE �E if'1E iF ik iE iE iE iEiE iE �h-1E-7F iE jf if if df ih ih iE iE D E V E L O P M E N T S E R V I C E S R E Q U I R E M E N"T S ZONING APPROVED HY � P� DATE: J� HUILL�ING APPRUVEU EY : DATE: /,. � � APPLICATION ISSUEU BY: LATE• , �k9Fikif#iE#�9k�E9FiF�ikiF"vE9EiFiE'vEiE-1f�ihjE �e -T �lE3f�fiE'�'7E�E�kdE3FiF�iFiFa�iF��ic�-iF3F LEGALIZATION:N F E E S U M M A R Y STRUCTURAL SEGMENT:Y BLLG PMT PLUMHING ELECTRIC MECHANIC-' , FIRE SMIP/RES GRAUING PERMIT 385.75 , : "�, 2.88 - �� ;, SMIP/NON-RES PLAN 250.74 ". ' " ' IS5UE FEE . �- , �' l '�` , BUILDING-DZV-> PERMIT ISSUE PLAN-CAEGK � ;>•TOTAL PAID UUE TOTALS----> 388.63 O.UO 'Z50..79 ' �639.37 039.37 .00 REVENUE DIVISION TOTALS--> COLI;E�TEU: '<7 b39.37 OVER/SHORT: .00 BLDG PMT PLUMBING ELECTRIC MECFiANIC ;FIR&:� SMIP/TOT GRt�LING F'LAN-CHE�K 385.75 i" �� ' 2.88 250.74 r.` i if iE if iF 3E 1E iF jE 9E jE jE jf �E iEik jk iF iE it iE iE 1F iF if if it 1E df k iE jE iE if iE iE iE.iE�3E jE iE �lE iF�9f * 3E �E iE 3E iE �1E if �E iE iF �E �E �F fE fE if �F iE if 1E 1E �F iE if iE �)f iE �E �lE 3E 3E iE iP jE jf I N D I V I D U A'"L �. rF E�E �� B R E%A K D O W N .1.. . � TYPE QTY D E S C R Z P T I' O" N • �"• UNIT COST TO'PAL COST SFR 427 RE5-CONCRETE bLOCK WALL ��• 6- / FT: 20.00 8,540.00 SFR 337 RES-RETAIN WALLS UP"TO 6 FiT `/ FT-, b0.00 20,220.00 END OF FEES �5, � F F � ' �` � (5151-aB.WP) W�no-BuiMvq85efery:drea Fle� ery-Appfrani:Fnk-Rwenue:0okenioFA+asmr � w �8-21-1997/10:16 Afl/5639.37 kCPTq:01 a511132 PEkPtIT:084336 � CONSTRUCTION AND PLANNING POOL PA APPROVALS Permit # Date Inspector APPROVALS Permit � Date Inspector 1. TemporarY Electrical Service or Pole 52. Pool & Equipment Location 2. Soil Pipe�Undrgrnd. � 53. Steel Reinforcement ' . 3. Electrical Conduit Utility-Undrgrnd. � 54. Forms 4. Electrical Conduit�Undrgrnil. � 55. Electrical Bonding 5. Steel Reinforcement �►2-q� �p�" 56. Rough Plumbing & Pressure T,est 6. E{ectricalllFERGrnd. 57. APPROVALTOCOVER•GUNITE' ' 7. Footings � 3��Rg (pGG� 58. Electrical Conduit�Undrgmd. 8. Foundation 59. Gas Pipe, � Undrgrnd., Tesi 9. Water Pipe•Undrgrnd. ' 60. Backwash �ines, P•Trap, � Undre�rnd. 10. Stroctural F�oor Svstem 61. APPROVAL TO DECK 11. Property Sewer Line & House Connection 62. Backwash & Receptor-Final 12. Sewer Cap 63. Heater & Vent-Final 13, iioot Drains 64. Plumbing System • Final 14. Rough Plumbing 65. Electrical�Final � t5. Rough Electriwt-Conduit 66. Solar Svstem�Fina{ � 76. Rough Etearic Wiring ' 67. Fencing & Access ApProval ' 17. Rough W�ring Sign � 68. APPROVED FOR PLASTEflING 18. Rough Electrical-T Bar Ceiling 69. POOL/SPA SYSTEMS FINAL 19. Rough Heating & Air Contlitioning - FIRE DEPT. REQUIREMENT 20. Rough Factory Fireplace APPROVALS Permit # � 21. Ducts, in Structure 70. Underground Hydro 22. Ducts, Ventilating � 71. Product Piping � Gas ❑ Oil 23. Gas Pipe�Rough & Tesc 72. Underground Flush 24. Roo4 Framing 73. Undergrnd. Sto�age Tank O Gas � Oil 25. Roof Sheathing : 74. Overhead Hydro Z6. T-Bar Ceiling IStructural) & Monocoat 75. Dry Chemical 27.,FrameandFlashing 76. DryStandpipe 28. Lathing & Siding 77. FIXED SYSTEM FINAL 29. Insulation 78. FIRE PREV. FIfVAL 30. Drywall Nailing HEALTH DEPT. REQUIFEMENT 37. Plaster 8rown Coat 79. FINAL INSPECTION 32. Electrical Power Meter�Final 80. POOD CERTIfICATE ISSUED 33. Pinal Electric Notes � L('-�j=g7 �S_�- . _ �e�. 34. Finai Heating & Air�Conditioning 4,�- �.� ti.l'-'-S__-f°�-�=�-� 35. Final Gas Pipe�Test 36. Hood or CanopV , q� // p7 � b/�ss� �C� � r /. Lt G �Gt 37. Final Factory Fireplace ' 8p„��Qw �-/� � ,. ./ � �u� EJT ��i.r��.� 38. Fina� Plumbing � 39.WaterService�Final 3i}�.Q_Q �j� � .L vv " iyrs�' w/ 40. Gas Service�Final ��,4�✓ /' _ i�d � (!'.�.�� 41. Solar pomestic•Final � . 42. Backftow Preventer . �43. Backflow Irrigation � 44. Landscape IrriGation System 45. Sound Attenuation . 46. Handicap Regulations , ' � 47�. FINAL STRUCTURE & BU�LDING ;,L( �g �'��- ' 48. FINAL PIANNING 49. Electric Release to Edison ' 50. Gas Felease to Southern California Gas Co � � 51. CERTIFICATE OF OCCUPANCY No. Date � PARTY WALL A�REEMENT fourth THIS AOREEMENT, made and entered iMo thia —_. __._. ... eay of August � yy and between Newport Heights Two, L.P. herelnmmr rarened to es "LANDOWNER; � and James C. Guthrie, trust herelne}ler reterred ta ae "Ap,IACENT PROPEAI'Y QWNER:' N ie hereby agreed tl�at e perty wall will be conatruCted on tha property line �„ 385 and 378 East 21st. Street wam.�s o� r�mi�a a�o„�m«� --. -.. ._._ In the qty of C�te Mesa, Courrty of Orange, State of Calitornia, as per map recordee ... In Baok 42Q , Pege 232 of Miscellarreous Mapa, in the oifiee ot the County Recorder m sa�a coumy. rne pany wau snan be By footing only . permiried to encroach _ _: .: . . _. from 379 E. 21st. Street IN W1TNE3S WHEREOF, the parties have er�tered into this Agreement �he day and yeer firet above written. .. �. ` .� - �ji.% i • !�.! � ��O • ! Newport heights Two, L.P. wm. nrn.a a rrw� 1501 Westcliff, Ste 260 Newoort Beach, Ca. 92660 (�) no�w PROPERTY OWNER �'� C Guthrie, Trust� -ANthorized Agent Neme (rypce ar Pnr� �� 1810 Calle De Sebastian Santa Fei New Mexico 87505 ��cama� OFFICtAL SEAL NOfARIZATION RE-0UIRED �� NOTARY PUBLIC � ALICE L. SENA .�;,,,p,, S7ATE OF NE7W ME%ICO , My Commleslon Explred=�� Ny > PARTY WALL AGREEMENT THIS AGREEMENT, made and entered into this twen[ie[h August ,by and beiween Newport HeiRhcs Two. LP hereinafter referred to as "LANDOWNER;' and Roy R. McCardle hereinafter referred to as "ADJACENT PROPERTY OWNER" It is hereby agreed that a party wall will be constructed on the property line betwBen 379 East 21st Street and 2085 Tustin AvQnue (Add�ess of Adjoining Properties) Costa Mesa day of in the City of Costa Mesa, County of Orange, State of California, as per map recorded in Book 426 , Page 23z of Miscellaneous Maps, in the office of the County Recorder of said County. The party wall shall be permitted to encroach by Foocings only IN WITNESS WHEREOF, the parties have entered into this Agreement the day and year first above written. LAN WNE ADJACENT PROPERTY O .�'��si•�ex---� p�lt�-��t-�-n — � �arsr ,Z'�� (Signature) (��Q-f 1—.v�. (Signat Newport Heights Two, LP � Rov R. McCarelle Name (Typetl or Primed) Name (Typed or Printed) 1501 Westcliff Drive, Suite 260 40 Orchard Lane Newport Beach, CA 92660 Middlebury, PA 17842 (Adaress) 1908-a8 (Address) NOTARIZA710N RE�UIREQ I ��ut�ga MY ��sTs'ron � Publb CouNy �e 9. 2aey 10.o t2n � a J I�MR'TY WA�L A1GIREEMENT iHlB A(31�EMENT, mada end emered Irrto thia Twenty Ninth _ AM�Yst ,�� N�wport Mefghts iwo, L.P. M�NnMM� f�Nrtsd to M„UWGOWNEq�, � Mr. Eug�ne Boero hN�kMfIR nh��d fo �e 'y1D,lACENT PROPEFiTY OWNER:' N I� hsrrby spiwd M�et a p�rty watl wlll De construoted on me property i�ne �� 20�9 <i�td�u L.ap• and 379 East 21st. Strs�t (�aa... d �d�or��e r,w.inw� Mi lh� G11� cl �bMr 1�A�, Gbunfy of Orange, State ot Califomia, as per mep recorded day ot Ifl Opefk�� , i�'ep� Z�� d Mlecellaneous Mope, in the oftice of the County Racorder d..a co� n,s �,�.nMi be �,►,n�a m e��n by rooung o��y bon� 37� B. Z1at. Mn�t N� WRirE881NHEA60F, the p�tlen hew entsred into this AgreemeM the dey and pM► Ast �ooa w�l�. _ .,�_•_...c _ n...�at +�.1�ha Twe, �.P M Y Pvl,c�� P �f-�� ('y/Gtz�-� Go 6`.P fi9i�1' �i'67� rMw. (1► o, ywe� – �ao� wr.:ai�, sa zs� N�wport N�oh, C�. �2dd0 ADJACENT ppOPERTY OWNER C�,----.� 1 rol � . �.- r.►�e Mr. Euge„� Boe�o NNN�v.o a P�inlw � 1048 Irvin• �venue Newport Besch, Ca. 92860 �� .— .--- 1't '�► � 1 '•'1 ', 1 � CALIFORNIA ALL-PURPOSE ACKNOWLEDGMENT Stateof /t ,�.a�Q- County of � .� -� On t�� q s� before me, f� �-� d r.�-� (�-c h-�, OA E, TRLE OF OFFICER • E.O.,'JANE DOE, NOTAM %1BLIC personally appeared ��_ � ` -�P ,c�, NAME(31 OF 9tt3NEA1S1 known to me - OR - ❑ �- AU�HeY TUANEA � �+ r CQMM. #1062746 � `m � NOTARY PUBLIC � CALIFORNIA O � ORANGECOUNTY N �— �,�m��E�iresJune28,7999_i proved to me on the basis of satisfactory evidence to be the personJs� whose name is are subscribed to the within instrument and acknowledged to me that �Mefthey� executed the same in �ii's`'� Mer�eir authorized capacity�es�, and that by�'J� Fier�€i� signature�sj on the instrument the person,(aj, or the entity upon behalf of which the person,(�5) acted, executed the instrument. WITNESS psx hand and official seal. OPTIONAL Though the data below is not requlred by law, It may prove valuable to persor+s relyfng on the document and could prevent fraudulent reattachment of th(s form. CAPACITY CLAIMED BY SIGNED ❑ i NDIVIDUAL ❑COFPORATE OFFICER ❑PARTNER(S) DLIMITED ❑ GENERAL ❑ ATTORNEY-itd-FACT ❑TRUSTEE(S) � � ❑GUARDIAN fCONSERVATOR 0 SIGNER IS REPRESENTING NAME OF PERSONISI OR ENirtY(IESy DESCRIPTION OF ATTACHED DOCUMENT TITLE OR TVPE OF DOCUMENT NUMHER OF PAGES DATE OF DOCUMENT SIGNER(S) OTHER THAN NAMED ABOVE � t CTILIFORNIA ALL-PURPOSE ACKNOWLEDGMENT �, ► � �c State of l� Q� o��i� (/ � � County of �v/ �t� On i�'uc, c� f i �,. . � �/ � 7 before me, � � �. v� � � � � � we.., IVU �� ' Da1 �— Nema e� 7nle ol OHkar (e.g..'Jene Doe, Nanry W� personally appeared � � U K� / v�L Lec C!��t/fj-�1� S , Name(e) oi Signar(s) . . .,. %!r`�`._ ; � .. �i ( �t�% .. .. . ' '._ ,,, ❑ sonally known to me roved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capaciry(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted. executed the instrument. WITNES my hand and official seal. � . �B^eture ol No ry PubliG OPT/ONAL Though the inlormation below is not required by /aw, it may prove valuable to persons re/ying on the document and cou/d prevent Iraudu/ent removal and reattachment o� this form to another document. Description of Attached Document Title or Type of Document: 1 A R�� w'4 � e�.� Document Date: �v �l V S f �� l 9 i% Number of Pages: � Signer(s) Other Than Named Above: Capacity(ies) Claimed by Signer(s) Signer's Name: � ■ ■ ■ ■ Individual Corporate Officer Title(s): Partner — � Limited ❑ General Attorney-in-Fact Trustee Guardian or Conservator Other: Signer Is Representing: RIGHT THUMBPRIM OF SIGNER Signer's Name: ❑ Individual ❑ Corporate Officer Title(s): Partner — ❑ Limited ■ ■ ■ ■ ❑ General Attorney-in-Fact Trustee Guardian or Conservator Other: Signer Is Representing: RIGHT THUMBPRIM OF SIGNER O 1996 National NOUry AssaiaGon • 8236 Remmet Ave., P.O. Bax 7t Ba • Cenoge Pa�k. CA 9t309��18a PmO. No. 590] ReoNer. Ca0 Td4Frea t�OPBIfi-682� Q �. �J PARTY WALL A(iREEMENT THIS AQREEMENT, made and entered into this �V �h._. .__... ... eay of August � yy e�W between Newport Heights Two, L.P. herelnener retened w es "LANI7oWNER; � and Mr. J. L. Edwards herelnafte� reterred to ae "AWACENT PROPEFtTY OWNER." It ie heraby agreed N�t a perty wall will be construqed on tha property line � 2088 8 2084 Garden Lane and 378 East 21st. — �_.. _._ �nm�c d wl�+mo �� In lhe (�ty of Costa Mesa, County of prange, 5tata of Califwnie, as per map recorded In Book 426 , Pege 232 d Miscellaneous Maps, In the otffea ot the County Fiecorder d sa�a courny. �n,e parry wau snau be perm�ned ro encroacn _ By f°oting only from 379 E. 21st. Street IN WfTNE93 WMEREOF, the partlea have aMe�d imo this Agreement the day end ye�u first ahove written. P�✓� `a *AINQ��/�' �JveIADJACENT PROPEFiTV dWNER 7r�'r/� G��L P�� n ��- ... �s�.�»� tsiy�m�� Newport heights Two, L.P. Mr. J. L. Edwards H�rN (ryped a PMmse) Name (rype0 or PriM.d� . . 1501 Westcliff, Ste 260 2088 Garden Lane Newoort Beach, Ca. 92660 Costa Mesas 92627 t�) uaan,.� na+. NQfARIZATION REOUIRED � �� J PARTY WALL AGREEMENT fourth THIS AQREEMENT, maCe and entared imo thia —._. .._.... ... day of August , yy and be�ween NewpOrt Heights Two, L.P. herelnefter reterrad to es ��LANDowNER; � and David Robertson Trust herelnetter referred to as'ADJACENT PROPEFtTY QWNER:' It is hereby agraed that e perty wall will be constructed on the property line � 2078 Garden Lane aad 379 E. 21st. Street � ___ ._._ (MMees d NgoinlnB PropeNm) In th9 qty Of Cosls Mesa, County of Orange, Stete of California, as per map recorded In Baok 426 , Page 232 of Mfscellaneous Mapa, in the offiee of the County Recorder of said County. The party wail shell 6e By footing only permitted to encroacn _ _. . _ . irom 379 E. 21st. Street IN WfTNE39 WHEREOF, the partles have errtered into this Agreemem the day antl year firaf abova wrltten. Newport heights Two, L.P. David Robertson Trust Ndns (rypetl n PrlMee) Nams or PrirAedl �� 1501 Westcliff, Ste 260 17�Claremont Ave New�ort Beach, Ca. 92660 Long Beach�Ca. 90803 t�ee�en� tba�.� � NQTAHWUION REUUIRED _J CIILIEORNIA ALl-PURPOSE ACKNOWLEOGMENT $tBYe Of � %o f pH,d�`v County of �i.�� - Oc1 ��,2, /-�i9 7 betore m0, � u�� i2� i j u n-i✓� i�- —� DA7E NAM , T11LE Of OFFICEF � E.G„'JANE DOE, NOiARY PU9LIf,' personally appeared L7.� J��0 �• �, 6-�.'i-s � NAME(5� aF SKiNER�S) ❑ persona{ly known to me - OR -�proved to me on the basis of satisfactory evidence to be the person(s) whose namel,�s/are subscribed to the within instrument and acknowledged to me that �h€/t#aep-- executed the same in i her�tbeir i AUC3RcY TURNER^ � o .m✓ � COMM. #1062746 � � NOl�ARY PUBLIC • CAIIFORNIA p � ORANGECOUNTY � � My Commission E�ires June 28,1999 � �--------- --------- authorized capacity�iesj, and that by d�herft�ieir signature(S3' on the instrument the person(�, or the entity upon behalf of which the person� acted, executed the instrument. WITNESS my,h�nd and official seal. OPTIONAL ��-N„�-� �urw�une w Though the data below is not requfred by law, it may prove valuable to persons relying on the document and could prevent fraudulent reattachment of th(s form. �CAPACITY CLAIMED BY SIGNED JNDIVIDUAL ❑CORPORATE OFFICER ❑PARTNER(S) ❑LIMITED ❑GENERAL ❑ ATTORNEY-IN-FACT ❑7RUSTEE(S) � � ❑ GUARDIAN/CONSERVATOR ❑ OTHER: _ SIGNER IS REPRESENTING: - ru�.�E oF vEsrsow� oq enmvresl .. , DESCqIPTION OF ATTACHED DOCUMENT %ii n.Y�, L✓n � � / 7�� ' TITLE OR TYP OF DOCUMENT �..e e�,-s-7 NUMBER OFPAGES �� yils�7 DATE OF DOCUMENT SIGNER(S) OTHER THAN NAMED ABOVE y � �oonessaew�owa: 379 21ST ST wm�n'srw�EiFanx": NEWPORT HEZGHTS TWO �op�+ 1501 WESTCLIFF #260 NEWPORT BEACH,CA 92660 �cv�. Wuuxc �ooxus: AqClIRECT OP FNCdl6A: u"' CITY OF COSTA MESA — BUILDING PERMIT FLOOD; PERMIT NO: H 086654 PLAN CHECK NO: 00255-98 S CONSTRUCTION TYPE: PERMIT TYPE: STR uc. w_ UNi: c«mua«rowu�PACIFIC GRAND CONST. (714)631-7933 COMPACTORSYNWq 1501 WESTCLIFF �oo�ssN,B, CA ��: 734964 92660 uur:. 260 LICENSED COMN�CfOP4 DEttAHAT10N: I hesby dlim �vNs pmNy d perpvy thm I em fcwosd �vds pwe'vu d Cheqr 9 �mmm«wro.un secron �000l d omson a a me eue�sw dd arda.aw code. vd mr emm. e m nm roRa m,d anw. cmuc.no.:070118 uc.cuss: uc.No.: 73qg6/q E�{p/:/ p6/g/�y�//� Dma: Comreea: //"l//✓'�✓1 Y ( �—�/ ` OWNEfl BUIL ER UECLA �TON: I tseby elfiim uMer paW y al perNry �hm I am e�emq han the CorM1retlm lioenee lew la tlw bxiq eeuan (Seaion )oJ1.5 &aiaa� ud�Rdmoiu COEe: MY c�y a munb whiN iWw� a V�^d to muvua. Ner.'unpo.e. nolen. «repei my n�uctura. ttb b ea e�uenca. ebo rW�ow �M epplimM t« mch pemm to fJs a eqmd aalemem Nel In «Me r��e w� m me aw.�+ a o» com�mor. uoe�� + Icnaq�r z(o��ro .vn s.ao� r000) w or.vo� a a iro BiuiMss end Petlmiom Codel a ihet he a tln e uemq therehvn eM �M buw Irc tlw eAepeE uemqion. My vbbtion d Sepion )W 1.5 by any eppliunl lw e permn eubpda iha epplirsm io e riN peroM1y d ral maa Ran Me huMmE Adlae �SSOOp. � I.mownerMlheproperlYarmyempbyeeev.whwepnes�haiedeoompenseiion.MillAOlMxnA.eMIMeWCI�nemlinladeA w aMereE Im eale (Ssclion ]010, Bud�rou eM Prolesebna Code: The Canireclon licenae lew doea rwl epplyto en ownxd propMy who W ide a'vn0�'es Iherean, mM who Coee euch xak IimeeX or henell or Uwaqh he or her own ampinyaee. providod �he� such imprtwanmia ere nd imeMed a d1aeC la eeb. X, howma, �he WiNirp a'vnpv.emem o eold Milhin ma ymr d comda�ion. ths owrerbuiNm wJl hew tM WNen d povi�q M w 6he CN nd Wik or imqow for �M WT�e d eab�. � I. m ox�rr d tte pWeM. em utludwty conlreqnY wah limiaed contreciwa m camua Ne p4� (Setlun )OH. Bw'u�wa eM PMeaiwn COCe: The Canlreqve Licenes Lew Eoea m� eppy �o en owrer d propany wlio builds a impwo Ihmeon end who cnnlrecls Iw wrl� prol�e Milh e mnlmitar(e) Icensed Wnuenl �o I�e Conlretlm License Lew). � I em uamq uMer Sec�im: ` B. 8 P..G., br Nia reeson: � Deta: Umec I do heieby wnily Nm I em ewus d ud uMen�eM IM reQwremam M Galiwnu Heellh eM Sdeiy Coda SaAiam 25505.25SU. aM 255�a. ud Mel I a ury Mura buikmp m�eni will / wil z� (� �) � ro camply w1h viC tlete wdm ud tM npuiromew b e D�e lacwntructian n modifrmiontromlM �iaue ryTl.�anepemeni D'm�ia. Rudxuieloonmuaion eppFmion+en eaamW/mm IMro aoti.ia+e, Dela: �VW�� WOPKER'S COMVEN9�TION OECL/�R�TION: I Mreby dfirm uMer par�My d pr'ryry one d the tdbwinp Aetleieliom: ❑ IM1mWWmeinlenawNlkatadmusNloespinsumMxvhaa'mnpenedbn.e+pro.idedlrbySwun9)OOdtMlabar Gada. ln tM pe�mnenca d Ne M la wlic� Mu pxmil w inusd. h❑ in..�..�aw�o�.A.�«.�w�c.��..,�a�.ews«i�amoam.�.nswa..a,m.o�«�+«wm. rak fa xfi'sh Nw W� u musd. M' xalun' mmPd�ion "vuu�enca mrir end O�Y numis me: c�« STATE FUND EXPIRES vwev r�na 0 4/ 3 0/ 9 8 (Tho mcian roW na Ds comdxad / �M ro^�{ w M ms hurxbed dYbn Rlal a bv.) � I ceniy Nd'n Ne peAormence d Ihe wark Iw whch Ihu pmnil b i�vueE, I MeA rwl empb/ e�ry pnaon in vry manrier eo m to pecome wbjee io iM wrlun' oompevmion ler.+ d CelAomu. W pree thel Y I ahouM beaxne wibjW �o tM r.aAae' rompeiuetion wiaum a Seqion J)00 d Rw lebor Code. I duA 1 M h mmpy p�witium. od. � � 2 _�� W�mMp: F�N A b MC1M� MO/kM� N/�VMY�tl011 COYMQI IIYIIlIW111� N0 /fWl I16/i! N MpIOyM f0 MMIW pMlltlpllM GHI 11rw �q b m� hinNM fMus�M 0dl�n (JIPq000A ��ltlon b fM cwf ol wnpr�u(bM1 Asmeps� u povMW b� In S�ctlon J]06 0/ tM L�6or Cod. Intwut, nW �Ifom�Y'� lsa. CONSTXUCTION LENDINO ROENCY: I hereEy elfirm uMar panelry d perjury thm tMre u e amn�waion brdi'p epercy In Ne perlorma� d tM xM Iw wM1ich ihe pemiY u uvued (Swion 908), Civ. C). LENDEF'9 NAME LENOEN'S 1�UPESS: I cMily tlut I M�a rW this epplicetbn W rels Ihet Ne aEave'udnmotian b oonW. I ap�ee to mmply Milh ell dy eM couMy adi�eM.ee ME 9tnIB IBWf 2kImY 10 buiWip can9llKlnn vd hxebY eNhOr¢a ieC�nlelrvae Ol�hia mY �U M�er uD� �hB ebtvB.nMMtMGd qOpn�y 1Ofi09pBdion""P°'°'RONALD LEGRAND pyy Nemo � �^ /� � ii Y Dme: SpneluredOwied�penUApp uGm�rma . (5151-16 WP) W�na-Buikvq 8 Selery: areert-Fle; Cenery-A00��: Rnk-Revenw: (bMm�od-Assmaor J� PERM NO: B 086659 GOVT: N SUPP: N PURPOSE: OTH JOB DESCRIPTION : 270LF BLOCK WALL SQ FT: 270 CLAIM VALUE: 5,400,00 CALC—VALUE: 5,900.00 GROUP OCC: R-3 / COMMENTS: 270LF "PROTO—IZ" POST—TENSION WALL x��r��r*��r***�r**��****x�*****x�r*�r�r**�*+t+��r**�e��r*�e**�**�***+�+�***�r*�***�+�*+�r*�r***it+rit Z O N I N G R E Q U I R E M E N T S S E T B A C K S ------------ MAIN HUILDING ---------- --------- ACCESSORY BUZLDING --------- FRNT: FT IN REAR: FT IN FRNT; FT IN REAR: FT IN LEFT: FT IN RGHT: FT IN LEFT: FT IN RGHT: FT IN PARICING REQ: PROV: PARCEL: 92623239 ZNE: R2MD REF NO: PLANNING NOTES> CONSTRUCT 270 LINEAR FEET OF BLOCK WALL—NOT TO EXCEED�6 FT I > N HEIGHT. +r+t�r�r+t*�t*+�+t+�+��t+t*�r�t*�r�t�t�t*+t�t*�*xx**x+t*�t�t�r*�**�r�r��t*��t�r*�r*�t�t**+��t*****�t*��t**�r�t*�c*��t*x D E V E L O P M E N T S E R V I C E S R E Q U I R E M E N T„S ��. � " Y' ZONING APPROVED BY f-�A1—{C DATE: �'�-o `l �I7 &UILDING APPROVED BY : c+, DATE: �� APPLICATION ISSUED BY; 1bY DATE: �C�Y '.E1EiEjE')Plk'�afiEiE�('1k'1E1EiE3EiE�1EiEiElfiE iEiE�EiEjE3EikiEifif��i *iF LEGALIZATION:N F E E S U M M A R Y STRUCTURAL SEGMENT:Y BLDG PMT PLUMBING ELECTRIC MECHANIC FIRE SMIP/RES GRADZNG PERMIT 112.25 ,54 SMIP/NON—RES PLAN 72.96 ISSUE FEE BUILDING—DZV—> PERMIT ISSUE PLAN—CHECK TOTALS----> 112.79 0.00 72.96 REVENUE DIVISION TOTALS--> COLLECTED: HLDG PMT PLUMBING ELECTRIC MECHANZC 112.25 TOTAL PAID DUE 185.75 185.75 .00 185.75 OVER/SHORT: .00 FIRE SMIP/TOT GRADING PLAN—CHECK .54 72,96 1f if if if if if if if iE �k iE iE it if if if 1f 3E iE iF jF iF iE iE if iE i' 3E ik 1E iE iE if iF iE if if iE 1f 1f 1E if K ff iE iE iE 1E �F iE iE if if iF iE if iE 1E if iE,�f iE iE iE jE iElE iE if iE if iE iE iF if iE i! iE if I N D I V I D U A L F E E B R E A K D O W N TYPE QTY D E S C R I P T I O N UNIT COST TOTAL COST SFR 270 RES—CONCRETE BLOCIC WALL / FT. 20.00 5,400.00 END OF FEES 81—E8-1998/12:49 DM/f185.75 RCPTt:BI-8B1B419 PERMIT:B86654 CONSTRUCTION AND PLANNING - PO� < SPA APPROVALS Permit # Date Inspector qppROVALS Permit # Date I�spector i, Tempor8ry Electrical Service or Pole 52. Pool & Equipment Locatio� 2. Soil Pipe-Undrgrnd. � 53. Steel Reinforcement � 3. Electrical Conduit Utility-Undrgr�d. 54. Forms 4. Electrical Conduit-Undrgrnd.. 55. Electrical Bonding 5. Steel Re�nforcement � Z��jg �c�� 56. Rough P�umbing & Pressure Test - 6. ElectriWl UFER Grnd. 57. APPROVAL TO COVER�GUNITE 7. Footings yL'�� 58. Electricai Conduit•Undrgrnd. 8. Foundation 59. Gas Pipe, O Undrgrnd., Test 9. Water PiPe-Undrgrnd. 60. Backwash Lines, P-Trap, O Undrqrnd. 10. Struttural Floor System 61. APPROVAL TO DECK ' � 11. Property Sewer Line & House Connection 62. Backwash & AeceptorFinal 12. Sewer Cap 63. Heater & Vent-Final � . 13. Roof Drains 64. Plumbing System � Final 14. Rough Plumhing 65. Electrical-Final 15. Rough Electrical-Conduit � 66. Solar SYstem-Final � 76. Rough Eiectric Wirinq 67. Fencing & Access Approvai 17. Rough Wiring Sign � 68. APPftOVED FOR PLASTER7NG 18. Rough Electrical-T Bar Ceiling 69. POOUSPA SYSTEMS FINAL 19. Rough Heating & Air Conditioning - FIRE DEPT. REQUIREMENT 20. Rough Pactory Fireplace � APPROVAIS Permit # 21. Ducts, in Structure 70. Underground Hydro 22. Oucts, Ventilating � - ' 71, Product Piping O Gas ❑ Oil 23. Gas Pipe-Rough & Test � 72. Underground Flush 24. Roof FrBming . 73. Undergrnd.StorageTank OGas ❑Oil . 25. Roof Sheathing 74. Overhead Hydro 26. T-8ar Ceiling (Structurap & Monocoat 75. Dry Chemica� � ' 27. Frame and Flashing _, 76. Ory Standpipe 28. Lathing & Siding 77. FIXED SYSTEM FINAL 29. Insulati0n - � 78. FIRE PREV. FINAL 30. Drywall Nailing HEALTH DEPT. REQUIREMENT 31. Plaster 8rown Coat . 79. FINAL INSPECTION 32. Electrical Power Meter�Final � 80. f00D CER7IFICATE ISSUED 33. Final EI¢ctric Notes: � 34. Final Heating & Air Conditioning 35. Final Gas Pipe•Test ' . ' � 36. Hood or Canopy 37. Final Factory Firepiace , 38. Final Plumbing � 39. Water Service-Final ' ' 40. Gas Service-Finai 47. Solar pomestic-Finai 42. Backflow Preventer 43. Backflow Irrigation 44. LandscaPe �rrigation System � 45. Sound Attenuation ' � � ;' �7' .,: �n 46. Handiwp Regulations � �3: 47. FINALSTRUCTURE&BUILDING �L�.s �� `�^� .D 46. FINAL PLANNING 4�- " z•- T 49. Electric Release to Edison •.= `� � ,..; ^i 50. Gas Release to Southern California Gas Co '�� 51. CERTIFICATE OF OCCUPANCY ��- ' No. Oate �NESSOFBUIIqNQ 379 215T ST os�+easruxeiriax.wn: NEWPt�RT HTS TWV AD°"�'�1501 WESTCLIFF � ' N.H. 92660 �vr�. r,wur+c �ooxess: AXCNRECTOflFN(tlNHN: �uUVZS ENGINEERING u+cxon�+c�smoxEEss: yqp0 CAMPUS DR N,B. C0Nf1"`T0"s""'�` PACIFZC GRAND Ct�NST CQlfPACTORSYNIWG 1501 WESTCLIFF uxr: A uc.r�o: � UM: CA 92660 (714)631-7433 A°0"� N.H. CA 1CND' 734964 926b0 �"� 260 UCENSED CONTRACTONS OECLAFATION: 1 Mmby ellim uMar pruly d pmjury Met I em I� uMs pwieons d Gheqm 8 �a�ma�,a •mn sx�o„ �000l a om.o� s d me aw�. �a a,d�� coa..�e mr wwo w m wn roR..�e dba. c c.No.:0701 8 uc.cuss: uc.No.: 7349 4 E}iP: 06f� 98 m,: r oo��.aa: �...-,-�..� pi 4�..w.1/ 7 a^--T H BUILOEN DE� LAPA ON: I hneby df�m ivder parWy d perjiry �he1 I em ezemq Imm the Conlreewe Limnee law la IM ' 8�Mw^ (�� 1 S Buenaea erd Rde�sbns COEe: Airy e�Y a oamiy xAirA ipuiree a peemn to omsvun. ettr. imqove. iWivh, a repei eny avunure: prior ro ila bweMe, ebo reQwme iha epWirenl la wcli pmn! b fib a egmE etalemenl tlet M a ehe ,em.ed wmiem io �ha c�wivan W ine Contrea«e Lioenee tew �CheNer v(mmmenana xan seaion rooa) a oi.vion 9 a �ns ousi'wss e�d Prdeaum Codal a Ihel M a eha u eRemq ih>ahan eM tM beao fa ihe dbped ssmmqion. Am'vnlmion W Seaun ]03t.5 by ary epplirenl 1« a permn wbjeae the epplicenl lo e tivil penelry d M mae �hen INe hurdred EdWs RSW�). � I.esaxmwa�MO!oV�Y«mYamVMwsxthwe0a?mtMiedeoomG�ution.wJldothexdk.eMtheao-unwenm�'nnenEaE impravemenla ere nM inteMed a aflereE lor eeb. n, nowewr. IM EUIMIip a mpwemeM ia voltl wilhin pre ym d mmpblion, iM owror-W iNx will heve tM buken M povinp M or eM dk � Wild w impove lar iM puryme d eab). � I. m ovmer d iM D�WeM. � e�tlu�rvNy conlredYp wilh liceneed wnlreclon lo conwua Me pmpU (Seaion l(M6. Bua"uma eM Prolessione CoEa: The Comrmae License lew Eoee iwt epply to en owner d propMy x1w buiNs ar impoves iMreon eM who wmrecia lor auM prol�s �I� e mnireaorle) IicanaeA Wfl�l lo the Comred«a Liceva lawl. ❑ I em ezamq vMer Section: B. 8 P.C., Im ihie reeeon: Dme� Owrier: I tlo hereby cenity iha� 1 em ewme d eM uMantend iha rayuirmmema M Cdilamie Haellh end SaIMy Code Saclione 25505.25533, eiM 255�1, enE It�at I or eny INun buildinp aaupenl will / wil nd (dreb one) rweE to camply wilh eeiA etate mEee enE iM reQuiremeMe lar epeemntamnavuetionormotl�celionhamtheR'v ue-O-Tyl�enepamentDislna.Reeidentielmnmiueionepplutiwrewazemqtmn�hase provisona. Deb: /pplcenl: WOHKEN'S COMPENSATION DECLRPATION: I Mroby elfirm wMer penetly W peijury ar d Ihe Idlowiip datlumioro: � IheveaMwi/meinlenecerlXkvedoonaentloeeMimurolarwvrkan'canpe�ion,uprwNedlwbySepion3MOdihoLaba COEe, iw IM parlarmerce d Ne xaM la wltich Ihie peimN ie i»ueE. ❑ I heva eM wil manten xvM1nn' ewnpeewiion imurenee. m isyuired by Seqion �]00 d iha Lebor Code. M IM peNormeMe W iM x wpk la which Mia permit ia iaeueE. MY wakert compeneation inwrenu wrier erd pdiry number are: c�"°�: ST7tTE FUAIn EXPIRES PdicYNumber: ��.7Ei09��-e-e-� 09/30/98 � �his secfion neeE rrol be complMetl Y Ne pemit ia M wro huMred Edlen �Si00f w b�eJ I rlly IMt in IM1e pMormerice d �Ae work br whc� �hb pamin u uauad. I e1Wl m� empby erry penon in arry menner eo n to na pme .�dae io ine Monen� comve�wion V.. a cdil«ni.. .�a rore. mm a �.naa n.�«re wbiw m �Iv xau.,� cro penu�ion pronsan M Smun 9)00 d Ihe Lebor CaEe. I ehel/l laJthxilh oompy wiTh pariabu.�/ De�e: ADWceM: �r5�� S e L ia�� Irq: Fellun ro�xun woMai romperuetlon covsnp� 1� un/awNl, ane Mtll utl/cf m rrployer M pIM� c nnu up ro om nvitlisd tnou+�M dwwn (stao,aooA ��n ro un cwt or w�vwvatan wmyu n pvvroea ror m Soctlon 91(IG ol Ms feGorCob, Intw4 +�tl eMmsy'i Iwa CONSTflU4TON IENqNO AOENCY: I Miaby elfirm uMm panaXy d per'^ny Ihel Ihen b e oorutruebn In&iq parv.y br tha peAormvxa d �M wak tar whiM �he Varmi e ewed (Seaion 909]. Cw. CI. LENDEWS HM1E LENOER'S 100NE%: I eerliy thm I hm raed Nu eppl�ion ud qele �MI Ne ebove inlormmun ia eaneC. l epiae to eanply wGh ell tlly end oamry adineeme eM s�ale kws iNelvq b WJdvq emWutlion eM Mreby eullprrza reqefenle�ivef d Ihe tilyto entar upan IM ebae-menloed piopMy lainaped'an pu�poses. RONALD LEGRAN�� (stsl-,e.wP) wnue-Builaiq85dary; `� , Rnk-Revenue: GolEenmA-Naevaor , . CITY OF COSTA MESA - BUILLING PERMIT PERM NO: E 0850A8 PERMIT NO: E 085048 YLAN CHECK NO: N Gt�VT: N SUPP; N CONSTRUCTION TYPE: V-N PERMIT TYPE: ELE PURPt�SE: UTH JOH DESCRZPTION ; F�OER POLE S� FT: CLAIM \IALUE: CALI-VALUE: GROUP OCC: R-3 / COMMENTS: X ****��*�;�***�e�r��r�r*�*��r**�r*�**;�*�r*��e�r*;��r��x�*�****��x��;�ri�***;�*�**;��*;�*;�;r*�+r� Z O N I N G R E Q U I R E M E N T S S E T H A � A S ------------ MAIN BUILDING ---------- --------- ACCESSORY HUILDING --------- FRNT: FT IN REAR; FT IN FRNT: FT IN REAR: FT IN LEFT: FT IN RGHT: FT IN LEFT: FT IN RGAT; FT IN PARKING REQ• PRGV; PARCEL; OGGGGGGO ZNE: REF NO; PLANNING N6TES> i if iF iF if iF 3f if if if iF i! iF if if ik iE if iE i! �k ih ak M 3F if if iE iE if iE 3E iF.iE iF iF if i'r if �f �k * iE iE 3f iF iE 3E iE iE iE if iE iF ik iE if if 9f ik iE ik iE if 3E �1E iE iE iE 9f �1f iF if iF ie iF if� iE if �k D E V E L O P M E N T S' E'"R V I C E 5 R E Q U Z R E M E N T 5 =y � Y. — ZONING APFROVEU BY �/ I BUILDING APPROVED HY ; •'��*%• APFLICATION ISSUED bY: *�� '1EiEifitififiEifiFiE�ih3fiF'IFi!-ififiFi6+EiF3f3F3F3F�F3F3F3F�F�r�F�if�E3f�F�'r�F �E i�iEiFi�� LEGALIZATION:N F E E S U M M A R Y BLUG PMT PLUMBING ELECTRIC MECHANIC PERMIT 66,00 SOY PLAN ISSUE FEE 22,00 BUILDING-LIV-> F+ERMIT ISSUE PLAN-CHECK TOTALS----> bb.00 22.00 0.00 REVENUE LIVISION TOTALS--> COLLECTED: HLDG PMT YLUMHING ELECTRIC MECHANIC 88.00 DATE: — DATE: DArs: o �*��**��;�* �� STRUCTURAL S GMENT:N FIRE SMIP/RES GR[�DING SMIP/NON-RES TGTAL PAID DUE 88.00 88.00 .OG 88,00 OVER/SHORT: ,00 FIRE SMIP/TOT GRALING PLAN-CHECK 3F iF if iF i6 iF#� ii iF iF if ie iF iF iF i't iF iF if dF 3k jE iF ie iE iE iE �e iE iF if iE iF iF iF if iF �F iE i'r jF iF 3f iE iF iF if �f iF iE 3't iF iE if if iF iF if iFiF iF �k ie iF iF iE if 3F if je iE if aY if ir �k iE if iE I N L I � I D U A L F E E H R E A K U O W N TYPE QTY" D E S C R I P T I G N UNIT CuST TUTAL COST ELE 3 TEMP SERV PWR POLE W/OUTLETS EA, 22,OG bb.00 END t�F FEES 18-86-1997/12:33 DM/f89.M RCPT1:81-8813377 PERt1IT:B85948 � CONSTRUCTIONANDPLANNING ; PQC<:,-":�-SPA . APPROVALS Permit# Date Iospector pppROVALS Permit# Date Inspector r i. Tempo�ary Electrical Service or Pote 52. Pool & Equipment Location �:LSoil Pipe�Undrgrnd. " � 53. Steel Reinforcement 3. ElectriGal Conduit UtilitY-Undrgrnd. 54. Porms � ' 4. Electrical Cond'uit-Undrqrnd. „ 55. Electrical Bonding � 5. •Steel �Reinforcement . 56. Rough Plumbing & Pressure Test i "6._ElectricalUFER,G�nd. - 57. APPROVA�TOCOVER•GUNITE 7. Footings � ' _ 58. ElecVical Conduit=Undrgmd. � 8. Foundatio0 - .�, 59. Gas Pipe, O Undrgrnd., Test 9. Water Pipe-Undrgmd. ; - 60. Backwash Lines; R�Trap, �-�, Und�grnd. • 70. Structu�al Floor System . 61. APPROVAL TO DECK 11. Property Sewer Line & 4ouse Connection 62. Backwash & Receptor�Fina� 12. Sewer Cap � � � 63. Heat¢r & Vent-Finai 13. Roof Drains . - 64. Plumbing System - Flnal 14. Rough Plumbing , � 65. Electrical�Final , � � 15. Rough Electrical�Conduic ' ' 66. Solar System�Final. • , 16. Rou9h Electric Wiriny ., - � 67. Fencing & Access.ApProvai � � 17. Rough Wirin9 Sign � 68. APPflOVED FO'R-PLASTERING 18. Rough Elecirica6T Bar Ceiling � 69. POOL/SPA SYSTEMS PtNAL ' 19. Rough Heatinq& AirAConditioning � � FIRE DEPT. REQUIREMENT 20. RoughFactory,Fireplace " " ;' - ' , APPROVALS.� .Pecmit# � � � � 21 . Ducts, in �Structurer � •� � � _ ' _ 70. UndergFound Hydro � 22. Qucts;Ventilating,:' � , ,� , �'71. ProducnPipingC7Gas '._�,.Oil 23. Gas Pipe�Rough & Tesc � �-, s ��. -* .� 7z. Underground Fiush • `24. Roof �ratning" ' � ' ' � • . � , 73. Undergmd. Storag8 Tar1k-,r�' Gas ❑ Oil 25. Roof Sheathing � • � 74r Overhead Hydra� • 26. T=BarCeiling (Structural) & Mono foat �- � - 75. Dry Chemical . 27. Frame and Flashing � � � . - �� +� 76. Dry Standpipe �- �28. Lathing SfSiding • -. '. - ", 77.,. FIXED $YSTEP�t rINAL _ 29. Insulation .� • � ' � 7g: FIqE PREV. FINA� � I "30. Drywall Nailing ;: � �. _ �' -. JiEA�TNy',DEP�. REQUIR�MENT �31. Plaster Brown Coat c .: . �� 79. FINAL IMSPECTIOPb ' 32. ElectriCal Power Met�rFipal ' � S0. POOD CERTIFICATE iSSUED _33. FinaLElectric > � - � . !O/�� Notes: - � ' � �34. Pinal Heating & Air Conditioning - � _ � � - � ; � � I 35. Finai Gas Pipe=Test . l r. 36. Hood or Canopy _ � _ � ^ � , ' 37. Final�FactoryFireplate� . � ". - , �� -- . - .� 38. Final P�umbing r � - - � 39. Water $ervice•Final ` ' ' � (F , , 40. Gas Service�Final • . . � ' ' ' 41. Solar pomestic-Final ' � � , . _ 42. BackflOw Preventer � � ' -43. BackflOw Irrigation ' ,. � � � � . � 44. Landscape Irripation System ' ' � 45. Sound Attenuation ,,.� � . �� ,.: - � � 46. Handicap Regulations - ' , � ' . " ' m � 47. FINALSTRUCTURE&BUILDING _ � G, �- v ' 48. FINAL PLANNING ' � ' �� ' ,�� , 49. Electric Release to Edison lo }►f' -" � JI W �'� 50. Gas Release to Southern Cafifornia Gas Co , _ � �%�� _51'. CERTIFICATE OF OCCUPANCY _ ' � " �..� - ,r�, c:.l No. Date .�oaasa�eu�nwo: 379 21ST ST avxursxweviwuvr�: NEWYORT HTS TWO eou�ss 1501 WESTCLIFF , � N.B. 92660 iwr�.�uuxc�ss: AIiCXRECT OR FNf+NEEX: ARCN.Ofl EtM.'SFD�XE55: ��,��5� PACIFIC GRAND CONST. CONf11ACi0ASYNl1NG 1501 WESTCLIFF uM: � CITY OF COSTA MESA - BUILDING FERMIT PERMIT NO: P 084139 PLAN CHECK N0: N CONSTRUCTION TYPE; V-N PERMIT TYPE; PLU uc. xo.: UM: (714)631-7433 eooness: N.B• 92660 CF' ue.ra.: 7349260 uxr: IJCEN9ED COHTXRCTOXS DECLAF�TION: I lwreby ell'rm uMer pareYy d perjury IMt I em licensad uMm poriaona ol Cheqer B (�munendn0 nilh ']aao m 3 d tM Buaimw md Pmlesaians CoEs. W mY 4mms u m/Wl laro md Mlea. No.: p/�uc.cuss: uc.No.: 7 9964 EXP• /�. 4� � ��,�:��3_ �P�. EN BUILDER DECLAN�TION: I hereby elfi�m uMm peroly d perjury tAm I em uamq Imm ihe Canmfae liwime lew tor Ne pppwip ieeeon ISetlion ]IXI1.5 Busiwa eM Adxabne Cods: Nry nY a mmtY Mv3� nV�ima e W�! lo anwtruct. e4s.'vnGrvn. lemd'nh, a reper erry suuclive, pria b ia ua�e�ue, e6o rpum ihe epp4w�t Ip euch penm �o Ne s ipnW aweme�a tlut he a�he a IrxneA W�auent to tha Pwe'vn d Ne Comrepore liorua lew IChaqa 9lcammao^i xdh Sen'vn )000) rf Divwion ] tl �hs Buemav end Prabniom Coda1 a �hm le n Ne e ezemq iherahan end IM Eem la the.eOepeE mamqion. My vulelion af Saeun '/W t.5 b/ enY aOD�� for e pamtil suEpce �M eppfram io e ciml ponMy W ml man Ihen frvs huM�ed OoOan �5.500D. � I.rooMmrdlheVW�YamYemDbYMwlhwapmniMi�decvmV�.WEolhewaF.endlheWucMsend'Wadd «werea m,.de �s«ion �aa. emre+. end aiae�.au coe.: me com�eaoA lim.e �..eo.. naewN�o en own«a papny Mw ddav «:nwwo �h.eon. end wn mm.ud� xak h:nseM «Mnd «Ihwpli he «her wm «nWww. wwide0 ihs wrh imM�maaa era fa in�erdeE a atlaed la eeb. tl. howowr. �M dntli^0 a inG'�.eM u edd willtin an Y� d mmV�un. tM owfwbudJer.�ill hew Ihe dvden d V�'�0 M or eM EN nal dnk ar'unpv.a tn Ne P�e W eebl. � I. m ovnw d ihe VrWaM. em mMien*N mntrmM vmh fioxaed eamrecYav b mimW tM V9� (Saeun'lOU. Bue'ura erd Prdesa'vu Cada: The Cant�etlm L�enm lew dam m� eVMY m en wnw d pro�Y Ma dnlde a viqeu'n �Miam md wb wnvena br wdi pcl+a+ wh e muratlule) licensed WnueM to ihe CaMretlm Liwm� le'vl. � I em uanq urder Sxtim: B. 8 V C..la Nn �maon: ��' ' o�.: o�..: I do M1ereby cenM �� ^ eware d vM uMenwM Ine mQuiremema W Celiwnie Heellh eM Sdey CoEe Seeiom 25505. P5S3J, end 25531, eM Nm I a erry Mure WilGrp mvpeni will / wil M(rirtb ons) rieM io canply wY� uitl mta mEa eM tM npu"vemmb br e re�mtl Iweonslruetion«mod'ifiralionhamlMAr�l.iviapemem Dimna. Reudanlil wiw�utlion eppf Wiomuaexeenqhwn thsea Dele: AppliceiM: WOPKEF'S CONPEN5ITION UECUPATON: I Mreby elfiem wdr peneM1y d perjuy wn W IM IOAoxinp Eaduuiom: � IMwudWmeinienacenfuteWawum�to�atliimnlaxorken'compnWion,mpwidedtaby3se'vi�]WdtMLnEn c�, io, m. o«+o�,� a me .wn ia.N,Kn m�. v«mu �. ��a. � in.w.�dw�m�.Ana.•o�w�+mo��.m�.aw�eaws.a:na�aoam.�.n«cod..r«in.c.��.p.an. wak �a which mia oermn A mwe. eM w«ken' �pave�iop,iN�rq�mx ene pdiy nume« ero: EX P I R ES c.� 1 c� Pa�, N„me,,: 0 4/ 3 0/ 9 8 (rras eenion �reed �a b. mma�� / ur a�t e ror me nwim.e eouva R�mI n IsnJ ,eniy thm m Na pMamance d ihe work M whc� Ihu pertnil u ie�ued. I Mell nd employ arry peison in enY manrw eo n lo p curo subjea ta tAe wakne' eanprmuion lex+ tl Cafdm6e, eM proe Nn d bwro aibjen �o �M wekeie' c mpeneetbn Dr sbre I Seeun 9]00 d Ihe leba Code. I e1W11 ' h aomW �powmre� ome: l/ �od�u: � � mNp: F�9ws ro un rohai wnpwu�tlon rovwp� l� unYWW, �nG �IWI wbf1cM �n w+ploy�r ro MmfiW pwltlu uW clv/I Nnu 1q ro wa hintlietl �MuunO do/Mn (J�GO,GiWA Mi Mdltlon ro fM cwt ol rom�pw�wlbM1 tlamepu o prorltlstl br In s.caon.tms o� m. l.�eo, ua., �mr�,c .�w,rcomry: r.... \ CONSTfiUCTION LENdNO �DENCY: 1 heraby elfi�m under pwXy d per'�sy iMt �Mrt o e amA�uCnn bMvp epem.y tar Ihe �no�� a ms w� i« �+,d, ma o�� A�.d �sec4, xn. c�. cI. LENDER'S N�IIE: 1Q10EN'S �ODPE55: I<MM �hm I law neE Na epP�'� ud vma Ihe� Ne eboro iNamWion u canw.l eYM �o oomdY tih eY mYeM aouM' aduwvs vM stale lexa releliq to buiMip con%ruction ud heraby eullwrue �epreeentalrvm W ihu tlly lo en�s upon ihe ebwsmm�uned popery �«��'pBtl�D�`0�" RONALL LEGRAND Dme: ___�� (5151<e.WP) Whn�Buildiq85efely;Oreeri- Ia;Ce�arydpp4cen�;Pink-Rovenue:0okemaHReaeawr PERM NO: P 08913� GOVT: N SUPP: N PURPOSE: NEW JOB DESCRIF�TION ; DEMOLISH EXISTING APARTMENT BUILDGS SQ FT: CLAIM VALUE: CALC-VALUE: GROUP OCC: R-3 / COMMENTS: REF:B-84138, SEWER CAP �r**�****�r�*rt***��rx **�***�*�� *�*�rt**�r��r*�x **�*��*��*+r�r+r*�;��r*�r��**�r�* ��*� �it*� Z O N I N G R E Q U I R E M E N T S S E T B A C K S ------------ MAIN BUILDING ---------- --------- ACCESSORY BUILDING --------- FRNT: FT IN REAR: FT IN FRNT; FT IN AEAR; FT IN LEFT: FT IN RGHT: FT IN LEFT: FT IN RGHT; FT IN PARRING REQ: PROV: PARCEL: 00000000 ZNE: REF NO; PLANNING NOTES> i it i! ik it f! �lE 1f iE iF if if iFlE ff k ik iflE �f iE iE �f iE �E �1tlF iElf if iE 3E �klt iFlf i6 ik iF if i! ft M iE if ik iE iE ff fE �E * if if 3k ff 7E 1E iE 1P fF if iE iF iE ff iF if iE 1E iE �f iF it iF 1E iE if �E iE D E V E L O P M E N T S E R V I C E S' R E Q U I R E M E N T S ZONING APPROVED BY . HUILDING APPROVED BY : APPLICATION ISSUED bY +t�t�t+t�t******�*�r*�t***�* LEGALIZATION:N F E E S U M M A R Y DATE; DATE: STRUCTURAL 5$GMENT:N BLDG PMT PLUMHING ELECTRIC MECHANIC FIRE SMIP/RES GRADZNG PERMIT 8.75 25Y SMIP/NON-RES PLAN �-. ISSUE FEE 22.00 HUILDING-DIV-> PERMIT ISSUE PLAN-CHECK TOTAL PAID DUE TOTALS----> 8,75 22.00 +, 0.00 30.75 30.75 .00 REVENUE DIVISION TOTALS--> COLLECTED: 30.75 OVER/SHORT: .00 HLDG PMT PLUMBING ELECTRIC MECHANIC FIRE SMIP/TOT GRADING PLAN-CHECFC 30.75 if if ik �F 1f !E iF if 7f if if !f fE iE �f 1E jf 1k jE i! �f �f 1E 1f �E if �E iE fE �E if iE 1! iE fk 1f if ff 3f if iflE �E fElf ih 1E if 3E 1E k if iE if i! fk �F iE ik 1f if iE 1k 1E �E �E jE if it iF it if if if iF iF iE if 1E I N D I V I D U A L F E E B R E A K D O W N TYPE QTY D E S C R I� T I O N UNIT COST TOTAL COST PLU 1 SEWER CAP / DEMOLITION EACH 8.75 END OF FEES 8.75 88-11-1997/02:21 �'PI/f3�.75 ecvrn:ni-eaiassi RERMIT:084139 CONSTRUCTION AND PLANNING �" POG_ .. SPA APrROVALS Permit# �_ � Date Inspector APPROVALS Permit� Date Inspector 1, Temporery Elettrical Service or Poie 52. Pool & Equipment Location 2.'Soil Pipe•Undrgrnd. 53. Steel Reinforcement 3. Electrical Conduit lltilhy-Undrgrnd. ' 54. Forms 4. Electrical Conduit�Undrgmd. 55. Electrical Bonding 5. Steel Reinforcement 56. Rough Plumbing & Pressure Test 6. Electrical UFER Grnd. 57. APPROVAL TO COVER�GUNITE 7. Footings � 58. Electrical ConduirUndrgrnd. 8: Foundation _ 59. Gas Pipe, � Undrgrnd., Test ` 9. Water Pipe�Undrgmd. 60. Backwash Lines, P�Trap, O Undrqrnd. 10. Structural Floo� Svstem - 61. APPROVAL TO DECK 11. Property Sewer Line & House Connection � 62. Backwash & Receptor-Finak 72. Sewer Cap �_ 63. Heater & Vent•Final 13. floof Dreins . - 64. Plumbing System - Final 74. Rough Plumbing . 65. Electrical�Final 15. Rough Electrical-Conduit 66. Solar System-Final 16. Rough Electric Wiring 67. Fencine� & Access Approval 77. Rough Wiring S�9n 68. APPROVE� FOR PLASTERING 18. Rough Electrica�•T Bar Ceiling 69. POOL/SPA SYSTEMS FINAL ' 79. Rough Heating & Air Conditioning FIRE DEPT. REQUIREMENT 20. Rough Factory Fireplace -� ,' APPROVALS Permit # 21. Ducts, in Structure ... -- 70. �Undergr6und Hydro 22. Ducis,Ventilating -� , , � �� Jt. ProductPipingC3Gas ❑Oi� 23. Gas Pipe�Rougt+ & Test �� 72. Underground Ftush 24. Roof Framing . � _ . , 73. Undergrnd.StorageTank OGas ❑Oii 25. Roof Sheathing � � 74. Overhead Hydro 26.�'i-Bar Ceiling IStructural� & Monocoat "� 75. Dry Chemical 27. frame and F�ashing . ' 76. Dry Standpipe •, . 28. Lathing & Siding - - - 77. PIXED SYST�iv1 FINAL 29. Insulation �. 78. FIRE PREV, FINAL � - 30. Orywall Naiiing • - � HEALTH DERT. REQUIREMENT 31. Plaster 0rown Coat . . 79. FINAL VNSPECTION � ' ,- 32. Eiectrical Power Meter�Finai �� ' � _ 80. FOOD CERTIFICATE ISSUED � 33. Final Electric Notes: ---��.''�-�� . - 34. Final Heating & Air Conditioning . 35. Pinal Gas Pipe•Test : . -_ - 36. Hood or Canopv � -- _. 37. Pinal Factory F�replace .` ,,,,�- ' 38. Pinal Plumbing .�- St �� G 39. Water Service-��nal , 40. Gas Service-Final r , " � - • 47. Solar OomestirFinal � - ' „ . 42. Backf�ow Preventer � � . - � � 43. Backtlow Irrfgation - � _ 44. Landscape Irrination System . -� . - . � 45. Sound Attenuation , � 46. �Handicap Regulations � - . 47� FINAL STRUCTURE & BUILDING � 48. FINAL PLANNING ; � 49. Electric Release to Edison � . 50. Gas Release to Southern Ca�ifomia Gas Co ' � , 51. CERTIFICATE OF OCCUPANCY � • No. Date ' I.GSPESSiF81ALOQY.: aE�RSNAYEIFqpWN: 379 �isT sr moxEu NEWFi�R'I iil5 TivV 15G1 WnSTCLIFF N.b. 926bG �cv�. Yuir,o .00xEss uNr: .ncxrtEcr an wrn��ffn: uc. w: u�aq�•g„��s: GUUVIS ENGINEERING Ouxr: 99uu CANPUB LR ��pry � N,&. CA g 2 b b V �a„p„�,o�,,,,,�„�rACIFI� GRANL CUN5T. i719)o31-7933 15"vl WESTCLIF.F �o� N.li. �� lA ��.: 7�99b4r' IJCENSED COMPACTOpS �ECI�XATION: I Mreby ellim in�&rppwly d pxjury tM 1 em �amatl uMer prorivimi �Cheqx 9 (mmnmom .mn s«Gm �aoo) a oiiuun a a me a�xw ena am�eaewn coee. ud mr 4rrm'm m �m �aw m,e eliae. CRY UC. NO.: LIG CLA54: LIC. NO,: 0'i" 1 . i349 4 XP• G'/ �Dma: Comraaa.� � � OWNER BUILD P DEC NITION: I he�eby dfimi urdar pp�ely d perNrv �� a�q �� iM Comrapm Liceme lew la the IdbwnB reesm (Setlion ]W1.5 &nirae eM Prdesaians CaEe: MY ciY a muniY xTJtli nVwm e P�C lo ovetrucY. etlr. mWaw. demdah, w repai eny ewnuro, pbr b �a'ssuarce, a6o reQui�u iM applimM ta wch pemN to fib a eqmd �Itlemenl tlW M a ehe 'e licensetl W�b^� �o the poveiom d ihe GonVanora licenae'lew �Cheptm B(oommendrp Milh Setlian ]uW) d DMubn a d ihe )uainev eM Prdmum CaAel a tlw he a eM u memq tMrNmm ud tM Maa ta Ihe dbpod azemqian. My vulmion W Sepion ]W 1.5 by eny epplicenl lor e parmN eubpds Ihe apDlceM b a chnl penelry d ml mas Ihen Me huMmE Adlen �5500�). � � I.mohtqtWlMPWe�YamyemO�M�wYhwaV�mllieisoboomO�Wun.witldolMwark.e�MNesWnunenalo-uaMeE w aHered Im eele (Sac�ion )OaI. Buainen end PmleeNone Cade: The Conireclae Limroe Lew doee rwl eyplyroan ovmmd qopMy wlw WiM n inpro+m thereon, enE Wq does euM xwk himxll a Mne� a Ihewqh he a hx own empbyw. povided Ihm euch impovemeM� are rot imeMad a oileieE lor e9b. II, Mwever, lhs buiMirp a inprawnam ie aold wnhin ona yw d oompbtion, Ne owrerbuiNer will heve IM buNen d povinB he or ehe d'd �w build a improw Iw Ihe WNaa d eab). ❑ I. u owner d iM propany. em extluervely conlraqmB'uil� IiceneeE conireclon lo wnetrud iM qol�= (Seaion 1014. Bue'vime eM Prdeaiona Code: TM Comretlon Lican» lnw doee � apply io en ow�wr d qopMy who builde a imqovm Iherean enE who mnVazn la wch pqws wnh e oomndor(e) IiceneeE W�� o IM Con�rmoee liunea lew). � I em e�emq unEer SMbn: r� B. 8 P.G.. br th'v reuon: Dele: Owier. 1 do hareby uniry Ihe� I em ewers d ud urcbmenE tM requiremame at Cdlanb Heellh ud Sdery Cade Saqiona 25505, 25533, eM 2553a. vd tlw I a eiry Mure buiNirq m�pem will / wll mi (�4 aw) � Io camqy wIh uid qela cadee eM IM,epuiremmpe br epe�melamnsUuctionamodifmionhomiMAi u3�l�y aupemsXDipntl.RuksnielmrmwioneppfrmiomenaumqhomCeea yaisone. Deta: �od�: WOHKER'S COYFENSATION OKL�N�TON: I heraEy dhm udr pmMy d payry ans W the IoOow'vp Mde�etiom: ❑ � new.m.d meieuei� e unai�su a mnw,� �o.w:iuur• for xaken• oomo«uuon. n po.iAed �ar W s«an aroo d �ns lemr cam. �« ma �no�. a m..ax i�..+:�n um wme 4 wwe. ❑ �ne�a.mname:ven.bnd.•oomo�un'u�wnnce.e.n�uvaeMs.amarooam.�.no,coa..a.�heoNm�u�vew A work ta whitli tliu D� u usW. M' warken' mmP„emion iwnazs mnier and GdkY wmMr an: c�;. SypTr arrnin EXFIRES Pa�N�m^^� aa��aeu��s�� 09/30/98 his awim nsed roi b mnWetM M Ns P�t e M w hvMnd Eolai It�mi n ImJ � I oen/y Nm in Ne pMamence M ihe wak fa whicA ihia pem�A a iewM. I MeP nal emqvy ury preon in erry menmr eo m lo becmie abptl �o �M xw4se' mmpanWion N�w d CeNortYe, enA ep�es tlw C I tivtltl beconr aibjet to �M raM1xe' �o�� oqm�� see� a�ao a ine �no, cee.. i.iwi imy�n �,w ��.. � WamNro: FWtin ro ueun wh�n' mnpru�tlon cm'�rM l� unMMW. �ntl N�II rOM �n rMloy�r b crhNrel i�tln entl NMI finu �q b om h�nsrstl fhouaud Ca/Mn (J1GqOWA M Mlltlon b M� cwt ol ronp�ns�fbM1 rYrrapu u povMM br In S�ctlm 9)O6 0! tln la0ai CaY, Infwt ��mry'� !ww CONSTPUCl10N LENDINO AOENCY: I hmeby NR�m uMr parolry d pmjury Ihtl Ihae o e cvnalwfion kndinp eperv.y Por Ihe �enom,erce a m..� m. ,dw� me o«m� 4:.uea Isedo� �on. c:. c�. LENDEF'S NMIE: LENDEfl'S �DDNE54: I Ceruh/ IhO� I heYB IleE Na MN�e�m tld tlH111hq IM 1WIe IMCTWiOn m CqAtl. I Wiee IOcomP�'/ YNh GG olY pb GnMyddmBros eM atme lewe raW iq ta WJEip conmudion vd Mraby einhoras repreeentmivu d Ihu wry io omer upon tM ebo.e�meMioned papsy la uupetlpn qttD�. RONALD Lf:GRAND (S15t-<fi.WP) Whde-BuildvpdSdely; Rnk-Revenw: Oddenro�Aeeeaor CITY GF CGSTA MESA - bUILDING PERMIT PERMIT NG; B GBSG71 PLAN CHfiCK NO: G2258-57 A i;OV'C: N SUPP: N CGNSTRUCTIGN TYPE; V-N PERMIT TY�E: S'ik PURl�GSc; NEiti JOb LESCRIPTZON : 22095F SINGLE FAMILY R�SZD. Sb75F GARAGE S� r'T: 2,874 CLAIM VALUE: 15"v,OG0.00 CALC-VALUE: 191,418.98 Gi'<iiUP GCC: ri-3 / CGMMENTS;.d45F FGRCH "PI.AN 1" ii'vf iE 3E iF it w ie ie sF iF ii iF iF iFit ii w if it ii w iF iF w ie iFif iE iF iE if if i't 3F if iF ii 3F it'se ie iF at sFit if ie iE if iFie iF iF ie ii iF iE'sf si ii vi iFi4 iF iF iF iF iF ie ii iE ii'si ir ie's' iF ii c u N I N G R E{;� U I R 8 M H N'i S S E I b A C K 5 F—g—N------1--p—T— MAINNBUpI�LLING1---------- --M------- ACCESS�RNY b�UILD1NG --------- LEFt� 2v FT fN A�H1i 4� �'� f� ��F�: r� fN n��Ii� t'� i� PAitKING REt�• 3 PAVV: —' • 3 FARCEL: GGGuGGuG ZNfi: A�ML' ke:F NG:,ukS'Iv5 PLANNING NtiiES>� ONH' 2—SI'OAY" UNIT W/AI'T 2—C�1R GAitAGc fONc OF o DcTACriED,,�' > UNI�f5'.�F,A COMMi7N INTER�:Si DEVELOFMENTi. FiEiriSL �. if iE if iei'r ie se iFiE ie i'r iE iF ie ie iE ie if'vFif ti i�ie if iiii iE.ie ieie iE i't i"e i't vF ie if if if ie if ii iiii tiE i'r ieiE ii iei'r iFi'e iF iFiP ii ii ii ii ii iF iF ii iE ie ii iiiF tiF ieie ie ie ir ii ii ic ii U E V E'L O P M E_N-T 5 E A V I C E S A E u 6 T R E M E NrT, 5 ZONI23G APPkGVED� bY � �� T�AI E; �� 1 - A p ' � 6UILDING t1PPRuVED BY. ;' v�� DATfi; �,-�.� .- '� � .•i •..' '. AFFLICATION ISSUEL bY:� ' liAiE: �: ' iEiei'tsFii�rtiiieiFiFicietiFifie'sfierii'rifi'rie�exsFsFiFie�r«�e�F7Fitiex3exwrexw�ie �e+e+e�xxxee��e+tiEi'rieifiiifieie'reie�r �rse+e�eiexxw�iiir LEGALIZATI6N:N F E E S U M M A R Y STFtUCTliRAL SEi�MENi:Y" bLLG PMT PLUMHING ELECT�7IC MECHeWIC F'IRE 5MTP/R�.S i;R11uTNi; PERMII 1,347.25 S 19.14 SMIPiNGiJ-RES PLAN 218.93 ISSUE FEE BUILUING-DIV-> PERMIi IsSUE FLAN-CHECK TOTAL PAiL uiJE TUTALS----> 1366.39 G.OG •218.93 1585.32 1585.32 .G"v REUENUE LIVISIGN Tt�TALS--� CGLLEC'lEL: 13bo,39 uvEl'tisHi�AT: ,vu BLLG PMT PLUMbING ELECTRZC MECHANIC FIkE SMIF/TGI' iiRAGTNG 2%LAN-CHECK 1347.25 19,14 ie iF iF if iF iF iF iF fi if #'sF iF iF # if iF ii iF # ii ii ii ii ii ii if ie ii iF if ie'st'si i4 iF iF fi iF w if ii if iF ii ii i't if iF iF'si if ie.!' dF ii i'r if'sf if if ie iF #ie iF iF if ii iE k if if w iF iF iE iF'v'r I N L I V I L U A L F E E B R E A K D u W N TYPE SFR SFR SFR QPY L E S C R I P T I G N UNI'T Ci)ST 't203 uWE-TYPfi V-Wi�GU FRAME -GOOL 8"v.i,"v 84 REf;-PA?IG CvVER-POST 6 SGLIL Rtivt� 16.11 �87 RES-GARAGES TYPE V ' "11.3G �NL G FE' � D �...�. � ocr o $ iss� D CITY OF COSTA MESA 1 '1'01'AL lVS'I L77,SL1.�3"v 1,354,"v8 12.SG3.1G - CONSTHUCTION AND PLANNING PQ�� PA � APPROVALS Permit # Date Inspector AppqOVALS Permit # Date Inspector � 1. Temporary Elecvical Service or Pote 52. Pooi & Equipment Location . �� 2. Soil Pipe�Undigrnd. 53. Steel Reinforcement ��+.Electrical t;bndui�Utility-Undr9rnd. 54. Forms � d;'Electrical Coniiui�U�d'rgrnd. 55. Electrical Bonding .��Eee� Reinforcemen't �(l�ct7 6'wf[ 56. Rough Piumbing & Pressure Test � ��'_El'ectrical FI�R',�fy(nd. �Q+(s � �wlL 57. APPROVAL TO COVER•GUNITE ,�: �. . 7:.Footin s � ' ` l � g . (�-(s qJ �v��L 58. Electrical Condwt;Undrgrnd. S�TFoundatior�l'7 �% / �`a2,(� (,�, /'w� 59. Gas Pipe, O UndrQrnd., TeSt � ds v w . , . 9. Water Pipe;�JndrgEnd. .y . 60. Backwash LinesrRTrap, � Undrgrnd. 10. Structural Floor 3ystem 67. APPROVAL T6�DECK 17. Prope�ty Sewer_Line &.4ouse C�nnection 62. Backwash & Rece�tor-Final 12. Sewer Cap ` ' 63. Heater & Vent-Firial ' 13. Roof Drains _i � _ 64. Plumhing System � Final 74. Rough Plumhirtg�-. �-t � 65. Electricai�Final 15. Rou9h Eleccriwl:Gonduit 'T 66. Solar Svstem�Fipal, , 16. Rough Electric Wuing�,.,� 67. Fencing & Accoss Approval � 17. Rouc�h Wiring SigR _ ' - -- . ,68. APPROVED F(,�Aj'LASTERING � � 78. RoughEiectrical:i,BarCciling° � ' 69. POOVSPASYST�MSFINAL � 19. Ro�gh Heacing & Air Conditionin � � - - ' .� � - � .r• r . ,; �FI�E kEPT. $EQUIREMENT 20. R 0C� f If lyCe ".r. ,x" a 'J .. '7'.' ��'1 T -� :7'J i o- .r� �9� � Y.y*� � d � S: S _ ? . ; PPR-0VGL� �� Pec2nit #� 21. Ductstin SttuciLre�a �' •^• -+ - F .S � � F : 7p, ��yndergr✓r�i� H�,fru . 22. Ducts,.yVeri�ilatJy�g '.�y � ,,�,,: , i 5 � K %77. ProduM P;ping Cqx LFO�I 23. Gas Pipe-Reughi& Test y�=! - _ 2•= r 72, Undergrp��rtd fJdSA = � -' �_ 24. RBof �ram�h . � t: , �a- • , � ,: r '� �., ^ `. r • 9 � � � � .,� J3,Undergmii.Stor�ay�Tank�OGas �Oil � 25. Roof $hea�.iin9 '' �;2.`Z�.qy .�� 74v Ovetttead Hvdre� �� y y( 26. T�ar �ieilin9 (Siruc��aq & Menri�oat '��°. ) :r Y ': � 7 i pry.Cher�i�al �� K �� ' _ � 27. Frame;and,Flas�iing� �. �:_�`y.�Zy� �:: ,; 76. Dry Startd�$e �- �� 26. Lathirtg &�idirr� ; k " � , '��:--�' .. r 77� FIXED SY§TEO�j �INA4 ., - �29. Insulation�r � y r - - V !p,p �,(,�j'1� 7g: FIRE PREV. FI'I�}TjL ` �=' � - - �`'1: . (�V 30. Drywall Nai3in�� ^'� ^ y ` � ;�j.�qg �(,ja;�. �j1F�ALT�DEP�. REQUIR�MENT :. � S _��-�_ - �i. Plaster Brop�n Coat~ � � ��^-' l�� f.W�� 79 � FINAL I146f?ECTIPjN +� ""'7 �2. EYctrical �owe�Metef��F'�nai � -' " ' ;r �8QyFO0D CERTIFt�ATE I$�SSJED, _ ,w � " . 3. P'r�al E ect�c ,� � � s : , � ^ � - � �� ) $ 7 � .7 _ - � ; Nd[es: 7 .• .• ,• 34. Final Ciea[ing &�Air c�s�d�:�o�i�y=� ,�; .;r, < , ; �p C�OLD-FE,`lI2-°s -P,�CIk,L-RfQI-JIREMEI�J� � "7 ' , J _ _r.�l "--_ r • .t � . � �� s 35. Fi�iai C',as f�ipe•7�.est n.-. .. �y K� � n j.� �.. �, r' � ------.-.,�-� " . yr _� . .. -• ,��y - �36. Hood or CanoPY � .7 - � ' - k ,', i` E '1�� r y , c V -� � - � i n, F • -� �-t • - T =T -_; • �7. Firial E'actoyy Fireplace �.r � -... _ -. i �! . . 38. Final P4umbing- �� - � -�� ' � K �' S - ; � _. �, y, �� 39. 1Na1er Service•Finai � ; � � " - � � I `4�, , �, � �' ` "' � . 40. Ga's Service#inal r-t E^� " r`' Tt I r ��_ t - T � 4 � .� f 41. Solar pompstit;Final �. = - � x � � ? r " � , i � r 42. Backflow Pieventer r � � �J ' > - • � = , =� -�-.i 'r a '1 -t � - 43. Backflo�v liriga�on r � �5 = � r � , � - - �� _ _ , � 44!+. Landscape3rrigation SYstem = - ,.��:: ^; - - �' '= '•� �, � ;� ' - - . - . . .� ^ . - -� �� g n i .- } 45r Sound At[enua7ion �. : . ,'i r " ; � i ; `: y j , 46� Handicap Regulationsi. - �7 � � , r •� _ � • - c �r - - t 47_ FiiVAtSTRUCTURE;& 6UILDING ., ��'� �� ' `� ' _ . • 4� FIIJALPLANNING ' �� .-.3_,�/_ " � - . . . � ., . . � �:� � ~ � 49. Ele'c[ric Releascrto Ed�son � '� i � �. ,. �. , - � " � _ � 5Q> Gas Rdeasa�to Souchem Californie�6as Co • � . - _ � � ^ � � � • . � - t - i - . 51,r CERTFFICATE OF OCCUPANCY y � � � � •= • � • No. Data � � i,n�csa�ew�nu+o: 379 21ST ST a"`�Rsr+�EiFa�a"": NEWPORT HEIGHTS TWO ' ��1501 WESTCLIFF #260 NEWPORT BEACH,CA 92660 631-7433 .vr�.�uiam �ooxess �xcxrtccT on eax�x: �NCN Oli Op.S 100flE53: uu xo.: uxr: UM: �erarsru� PACIFIC GRAND CONST, ( 714 ) 631-7433 ca+mAcrrnrs�uwa 1501 WESTCLIFF .00nrss:N.B. CA ��.: 734964 92660 uxr: 260 LICENSEO COMPACTORS OECL�fl�TION: I hereby N'rm unEer peraly d pajury Nw I em Ikenee0 uMa pwivions d Cheqw e (eommma�0 xil� Seelion 9000) d Oivieion 3 d Me Butirev end Pmlmabeu Code. ard mY Yoenw b in h01wu eM e11arJ. cmuc.No.:070118 uc.cuss: uc.No.: �q964 EXP: 06/98 Dele: Contretlar. OWNER BUI EH OEC ATION: I hereby elfiim unEer peneAy d NO' ihet I em eumq trum Ihe Conlradon Licenae Lew Ia Ma folbxinp rea+on (Sedion )031.5 Butir+a enE Prdemiona Cada: Any cYy a munly whitli ipuirm e pemiil to connvucl, ellx, improve. dsmd'eh, a ropei ury swcluro: pia b Ga emerce, eho repuim �In npplkan1/a euch pamA lo fib e eyneE �talemeM Net he a ehe '� IicenaeE punuem lo tM pa+eione al Ihe Contimae Limme law �Cheqx 91�mmendiq wilh Satlion )Oq0) d Div6bn 3 d ihe Y91fIBlf Bfld PfO�Ht10119 CiOdB� Of IhBI �1B Of 9�M 19 QlBfllp ��1BfB�Iq11911d I�1B NBIq �IX �he B��BQB(� MGIIIp1011. /JI)' VIO�O�M C� �lQM /O�t.5 by elry epdiun� la e permA subjxJa �M epd'cem �o a civJ penehy d rid more then INe �undrad tlWv� �5.500�. ❑ I.asoxwdlMP�W�YamYemdW�wlhwe9esm�hredewmPenWian.wJldoNaMwk.enENsahuclunwnalvNeMed a dlereE Ia eda (Senbn JO6�. Businev vd Prolnnions Cade: The Contrenon lioenea Law tloee rwt applyta en owner d propa'ly .eo aaa. « mawe, m.,�. d,a .�,o ma..� won� ��e o. n�di «mrwW w«n., o.� «�pm+e•. wwdaa mm wd, impmwnanb era M'vaeMeA a We�ed la aeb. tl. howe�er. ihe WaCmB a inpwa^aq e eold wnlvn ans Yser d comObiion. tlr owror-0uiNar WI heve IM WNm d pmirp he w ehe d'd rwi dtiM a impova tor tM qrtpoea d edel. � I. n owne� d IM pWMY. em mtluarely mLL2tlM �wlh fcemed wnVeclon lo rn�N�q tM p9�� (5etlion ]OM. Bufirwa ard Profworo Code: The Caarnfm Liwim lew Aon nd eppy b en wner d pWMY Wn buitL a enpwas ihaaon end Mn canirew kr o,d, pq«v �.iN a mmretl«Is) rcareed wnu.m m ihe eemrmaa lioans lee1. � I em azemp uMs SMion: B. a P.C.. br No �maan: Dme: �� . I Go MnW canM tlW I am ewua W end vdmstW Na iepu�emwtls d Celiarce Nsetlh aM Sela�Y Cada Saaioru 25505. 2551D. and 255�. end Ntl I a enY Nurs dn'Itleq o009� will / w0 rwi (rnda wr) need m cpnGN rih md pate aodes ard tlr nqu'vemarea br eDa�melaoonsuuclionamodifrabnhamiMl�i u�arepemeniD'atria.RmitlenlidmMruaionWO�dbroene�emqhomiMae o�widme. Dete: �CP«� W OPKEH'S COMVEN9ITION OECL�NATION: 1 heraEy elfirm uMx psWry d pejwy aw M tM IOAowieq Eedertlaa: � I heva eM xil meimen e cenLicele W cauent �o sep-"uwn br r.akaa' camparoetian. u prwided tor b� Sedian 9100 d IM laba COAe, lw �M peelormerca W Ihe wrk la wltie� thie permil ie oeued. �p in...d,a�:��m�won�n�oomo«�w�mw�.mnc��eMs.a�arvown,.�wo.coee.i«inaro�«�ain. wwk fa v.hitli thn pmmn u mued. My waken' comperuetion irourarKe mrrier ud pdiry numbm ua: c�;a.: STATE FUND EXPIRES vawr N�mea b 5 0 4/ 3 0/ 9 8 �9 s.crion need mr w romanee � �n. w�, o ror are mmdi.d ddla, rs�ool a. rm.) � I cMM � in Ne prloimemw d �he wak br wh'rh tMa paimil ia ivueE. I ehell M employ enY Va� in enY memwr o n Io becana wbjetl to tM w�Me�e' wmpaiumion lewa d CalLartue. md ep�aa Nm J I ehauk Eecme abjetl �o tM xarYen' canM�+mion sms W ian 3]00 d tha lebar COEe. l�h�a]A[��p_� � wmPM IMu qarieoro. Dna: /� MW�+am: / /1�� m � Wemlrp: F�I n ro wcu roikw+' mnpwvetlon covenp� 1 uni lawlul, aM Nsll a�Ohel en �mplonr ro cHMixl ponatt/uW c/Hl fln� ,q ro om �intlM MouuM oal/an ftiP0,Od0A M Nd/tbn ro N� eost ol ronp�rwfbn� AsnNpu �i provltlW br In S�ctlm 9lO6al M� LeDorCOW, Infwl, uMettomsyi /w. CONSTHUCTON LOlqNO �DENCY: 1 haeby e1fi�m inder pmdry d pe�jny thn tAers u e mMr�qqn bW"uq epenry 1ar Iha peAwmercn d tM wark lar xfiirA ��u peimi u ea»E (�� ]. Gv. CI� , LENDER'S NAME LENOEP'4 �ODPESS: 1 eMiN �hm Iluw nad Nu eDdieaYm aM qma ihm tM ebwa'vdmretion e ronaa. I e0� lo eandY r.i1M1 eY mY enG mueY adireews W atele lexa ieW ip lo W3diq mmruCcn e�d M1mebY eNhorae repasentatiw dthu ay io erur upon tM ebava�man�ioneE piopeMy �«�"'P°°"�D�`°°'°'RONALD LEGRAND PnN N � ��r � Dme. Spn uradOwn rlpenVAppYtenJConlratln (515�JB.WP) Whne-BuiknpBSalely:Onan-Fb:Cawy-Appiwu:Pink�iavenue:0oken�od-Aieevor CITY OF COSTA MESA - BUILDING PERMIT PERMIT NO: B 086699 PLAN CHECK NO: 00297-98 S CONSTRUCTION TYPE: PERMIT TYPE: STR JOB DESCRIPTION ; CONC'ERT 155SF GARAGE AREA TO BONUS ROOM ,3 - ��a PERM NO: B 086699 GOVT: N SUPP: N PURPOSE: ADD SQ FT: 9,300 CLAIM VALUE: 7,000.00 CALC-��ALUE: 9,300.00 GROUP OCC: R-3 / COMMENTS: CONVERT PART OF GARAGE AREA TO 155SF bONUS ROOM �***�t*at***+�+t�t+t*�t***�r*******+�*atit�*x�3t*�tx�*�r�t***�t*it��**x��t�at****�t�t�t**�t3t**�t*+t**�t�t�t*x� Z O N I N G R E Q U I R E M E N T S S E T B A C K S ------------ MAIN HUILDING ---------- -------- ACCESSORY HUILDING --------- FRNT: FT IN REAR: FT IN FRNT: FT IN REAR: FT IN LEFT: FT ZN RGHT: FT IN LEFT: FT IN RGHT: FT IN PARKING REQ: PROV;_ PARCEL: 42623228 ZNE: R2-M REF NO: PLANNING NOTES> CONVERT EX 3RD CAR GARAGE TO BEDROOM PER OPTION. 2' UEEP > PLANTER/HUMPER O.H. TO BE PROVIDED AT FT; WON'T BLOCK�PKING. iE iE'7E iE dE jE iE 341F 3k ik iF 3E aE it iF jE iF if df iE if iE �f iFiE.,jE dE if dE it df it iFiF iE 1E ik if i6-k dE iE iE-lE �E �E �FjE iF if 1E �f iE iE iE-)f -7E �E iE if �E if iE ik if �k ik iF7�iF iE 1E 1k dE-lE-0E iE dE D E V E L O P M E N T S E R V I C E S R E Q U I R E M E N.T S ZONING APPROVED HY • � W��- DATE: � IZZ'�� BUILDING APPROVED BY": " DATE: �' . � APPLICATION ZSSUED BY: S� DATE: 1! C`�-R iEiEiEiFdE�FiE-1E#iE�ki4il�iEikjflEiEdEiEiEiEiF3FiF�-iFiFiFiFiF�FiFiFifiFiFiFlFiFiFiFTfTFiF�FiFiF�F �iFiFiFiFiFkiEdEdEiEiEikiEiE* jE�E LEGALI'LATION:N F E E S U M M A R Y STRUCTURAL SEGMENT:Y HLDG PMT PLUMBING ELECTRIC MECHANIC FIRE SMIP/RES GRADZNG PERMIT 162.25 93 PLAN 105.46 SMIP/NON-RES 'ISSUE FEE BUILDING-DIV-> PERMIT ZSSUE PLAN-CHECK TOTAL PAID DUE TOTALS----> 163.18 0.00 105.46 268.64 268.64 .00 REVENUE DIVISION TOTALS--> COLLECTED: 268,64 OVER/SHORT: .00 BLDG PMT PLUMBING ELECTRIC MECHANIC FZRE SMZP/TOT GRADING PLAN-CHECK 162.25 .93 105.96 iE iElE iE iE if iF iE iE if iF 1E iE iF ik iE �f fE jE �E if �E 3E jE if iE 3E 3E �E �)E �E 1F �E fE �E 1f 1E 1E �f dk 1E iE iElf iE �E %1f 3E 1E 3E fE iE iE iE iE 1f IE iE if iE ik if iE jf fE �E iF if 1E �1E iE iE iE iE ** if dE I N D I V I D U A L F E E H R E A K D O W N TYPE QTY D E S C R I P T I O N UNIT COST TOTAL COST SFk 9300 ALTER BY VALUE RESIDENTIAL NOZONE 1.00 9,300.00 END OF FEES 81-22-1998/IB:55 pp/i268.64 RCPTtl:81-8818568 PERMIT:086699 +r CONSTRUCTION AND PLANNING �� 'PA . Date Inspeetor Date Inspector APPROVALS Permit # APPROVALS Permit # � . 1. Temporary Electricai Service or Pofe 52. Pool & Equipment Location �" . 2. Soil Pipe•Undrgrnd. ' 53. Steel Reinforcement �. . 3. Electrital Conduit Utility-Undrg�nii. 54. Forms ' 4. Electrital Conduit-Undrgrnd. • 55. Electriwl Bonding 5. Steel Reiniorcement 56. Rough Plumbi�g & Pressure Test � 6. Electrical UFER Grnd. 57. APPROVAL TO COVER-GUNITE 7. Footings 58. Electrical Conduit-Undrgrnd. �-,� 8. Foundation 59. Gas Pipe, O Undrgrnd., Test 9. Water pipe�Undrgrnd. 60. Backwash Lines, P-Trap, O Undrgrnd. 10. Struttaral Floor Svstem • 61. APPROVAL TO DECK , � � 1 t. Property Sewer �ine & House Connection 62. Backwash � Receptor�Final ;' 12. Sewer Cap 63. Heater & Ve�t-Final 13. Roof Drains 64. Plumbing System � Finai �' 14. Rough Plumbing 65. Electrical�Final ,E - 15. Rough Electrical-Conduit ' 66. Solar SYstem-Finai % � 16. Rough Electric Wiring � _ ' 67. Fencing & Access Approval �� 17. Rougfi Wiring Sign 68. APPROVED FOA PLASTERiNG � � 18. flough Electrical•T Bar Ceilin� � � 69. POOUSPA SYSTEMS FINAL 19. Rough Heatin9 & Air Conditioning FIRE DEPT. REQUIREMENT . 20. Rough Factory Fireplace APPROVALS Permit # 21. D�cts, in Siructure 70. Underground Hydro 22. �ucts, Ventilating 71 . Product Piping � Gas ❑ Oil 23. Gas Pipe•Rough & Test )2, Underground Flush 24. Roof Framing 73. Undergmd. Storage Tank � Gas ❑ Oil 25. Roof Sheathi�g 74. Overhead Hydro 26. T-Bar Gei�ing (Structural) & Monocoat 75. Ory Chemical � � 27.FrameandFlashing `-'L�'_Gt� (Gw`L J6.Ory5tandpipe 28. Lathing & Siding 77. FIXED SYSTEM FINAL 29. Insulation �, �� /G[�G/- 78, fIRE PREV. FINAL 30. Drywall Nailing HEAITH DEPT. REQUIREMENT 37. Plaster Brown Coat 79. FINAL INSPECTION 32. Electrical Power Meter�Final 80. FOOD CERTIFICA7E ISSUED 33. Finat Efectric Notes: 34. Final Heating & Air Conditioning � 35. Final Gas Pipe-Test 36. Hood o� Canopy 37. Final Faaory Fireplace 38. Final Plumbing � 39. Water 5ervice•Final . 40. Gas Service-Finai 41. Solar pomesticFi�al 42. BackflOw Preventer , 43. Backflo'N �rrigation 44. Landscape IrriGation System � 45. Sound Attenuation ' ', n 46. HandicsP Regu�ations 4. 1:� 47. FINAL STRUCTURE & BUILOWG (�v�-�� '!.✓�"' - 48. FINAL PLANNING ��=. 49. Efectric Release to Edison .'.,:. 50. Gas Release to Southern California Gas Co ""• � �' :y/ 51. CERTIFICATE OF OCCUPANCY No. Date � S�C�H�U�I�L�E�R Residential Building Insulation Installation Record Batts & Blankets < Description of Area Sq. Ft. of Insulation R-Value � Thickness Ceiling R-�9 6,3/i..• Ceiling Wall Wall Floor EXTERIOR GARAGE CEILING R-1 3 m � TITLE 24 FOAM CAOLKING: If batt or blanket insulation has been installed in enclosed cavities, those cavities are deep enough to allow insulation to expand to lhe labeled thickness unless exceptions are noted above. Blowing Wool in Ceilings Nominal Net Sq. Ft. Minimum Bag Weigh[ Insulated No. of Bags R-Value Required Thickness Blovring wool, if used, has been installed in the ceiling in conformance with the manufacturer's requirements shown on the�bag. ' Location ; /r'�C-T �/55�� sc. o� �oc n �r,� � �'li}Nk � — 379 �/ S% s7.�FFi' City rnc�rn nnccr r�n Builder Company Name Signature Insulation Contractor Company Name S Signature Schuiler International, inc. I Building Insulation Division P.O. Box 5108 Denver, Colorado 80217-5106 Date ' � w 1 — �L O 'f' — �� qn/ — ,�._" � ' � � U V S � � • � ' �OTE ADDITIONS, DELETI INS, OR GORR! GTD V SION LL BE APPROVED e/ TNE PLAfJ�II , \ \ \ � . �B' APPROVED `ll�/7'25 — Tc� P — �/ � � w — By Oale � This set of plaris and pedt'ratlore MUST be kept on this job at all times and'A is unfawlul ro make any dianges a etlarelion on same wltaN wrilten pem�ssion tr�m Qie Divisim of 8uild'ng vM Safety, C�y ot Costa Mesa. / The stempNg f Ihis plen arM specif ltons SHALL NOT be held to pemiil a to 6e an approval of Ihe vbla(i n of any provisbns ol s�y u;y oi Cos��;:_ry-a OIC;nange and/a�tat�v. r These plans nd per,n� shail e�ire by iimila(ie� and ber,ome n�and v�d il th buiMin r ivorki=r-�. �ma!�cedam!mv.iniz!.^^_:1�.r.^..r!J9C§3(�3;d�rn�hin1fE0daysotis_ua.�ce. � I S � --��c._--- � g ' � ' II � I, 6 c" 4 � � � I � F�' �y �.. �l Kv" o.epf i � � , =•� �OIiJY/Yytl � I�. �i��X4��v��'�yY��s '/i" 6.Hr +/ nvT � � � 1zl $��' �/L � y oS�`Fo P/L �O� � IZ � IG 6 . �� , - �oJ t,� aK B hea�cij Do.��c '• ' ��k C fw(r�e�,5 � Vt,��wtti.i-o�n. 'r'J�f�f/�f�f ll1�l ., � 0' COSTA MESq PLANNING DIV. � �l.�IE�T TO BLDG. OEPT. RGEpG. � @1g�.. e, P7Tt � � l0 2��x �� d9-` �,.�+4, 3�g��x5" L�qs � �� /c , a''x ti'' rcoF�'�y s��c seaced �ro oxd �iR�i-�o Lo�.c/ ,]'. � Sw � FT 3-�q �e Z� sr s+. C.M -f 4 -,� ' - 3A�K _ v►�w - c�> a7�- !i'x 8' w,aw�nE �jOlTf WI��I pe� �o�nec+�„n1 � �. �►x4' wnp-�.rs w 1�� 1�Y.t�R g,. s 4'icy�� upriqh+l W/ 2x L'Tr�nl {�-".-- 7 � �� 1 � 1' DOJ.bIC 'Z �k (.� raF�e�r 0 � � x ti''roo�;�q ScIF Spac�d � DIVISICITY O BCOISTAjMESAA�TY pppROVED D o.ib�e 2`X g.r hcaa�rs � 7 c\co.�cnce I Min. ilGs set af plans and speairca�ioris MUST be kepi on this joh at all tu�s a�d il is u�awful to make any dianges or alteralan on samawAhoN written oemifssan tromfie Divisian ot Building — 5 I O�tl Safeky, SdY4f ��%esa _ T�splan and s�eaffcai��"r- `;Nq�L NOT be held to permA or lo be an approval cf the �ol^Uo any pwvision:' �r =nv %",: �;i Oosla �1esa Ordinance andlor Stata law. Tr.eca olans and permit shall expire by ii�� i;:c!ion �u�d berome nuii and void ii the huiWing cr �:a.; :; ,= ,�m-�:r.cad �n.r. m�:Mai""' ."!";`n-r !�a^, F�P3 ;dj c�i'h:n 180 days o1 isaca�cP.. Z',� �,'' �.dy.. 3/9'xs•' �.7s Ib'' o/� �_ 2 �xY � s�IF s�aac�d Oo��ccr Fis� w� 16 9o1J Son / Ml�T / io'c" \ 7x �• So�ra tiwnq�♦ �'S�ocktft ,� �x G� � �1os� ti�n3 7 M�N, [�eJblc 2XL �faueis v,�i�ti 7,• 1/�'�t g" g.h1t o.d �v�i Do.�b�c 1''x 8" ��ers wilh Z, yt�fc$�.i3ol�e w/N�{�f �2�%12�� Cenc.��c �ooi��qs �.� in G65 yy �raeke�S yi' Bol+f �. �r`l vpriql�ls � � � 3 .onxEsso��: 379 21ST �ST 59 avr+exsnu�EiFa�m+:NEWPORT HEIFGTS TWO �ooness 1501 WESTCLIFF #260 NEWFORT BEACH A 92660 �vv�. �uura �ooweu (714)631-7933 oNr: nncxnEcron�«a��nn:PHIL HARP ucwo.: 516409 m.xonexa•s�oo�a: 395 UNIVERSITY DR. uxT: M-4 COSTA MESA CA 92627 coxrnAcra+sru�HARP, PHIL GENERAL CONTRA (714)642-2913 cwm�croas�utn�o 345 UNIVERSITY DR ��COSTA MESA CA ucra_ 516409 92627 uxr: M-4 LICENSED COMRRCTONS DECLAflATION: I heroby dl'xm urdm penely d perjury �Aq I em Ibeneed uMar poviaiam W Cheqm 8 �eommenano wnn s.nbn �000l a oiVi.ion a d �ne ewnere ene v.ae.am. cae...ne mv �enae ro in �w� �orce mw e�me. cmuc.No.:045227 uc.cuss:B uc.No.: 516409 EXP: 06/98 ome: `^I `2J'1 �i a comraaor: � L'�' '' e OWNEN BIIILDEH DECLIRATION: I heroEy elfi�m urMer penely d parjury �hel I em uemq Imm IM ConVetlan licwe lew tor iM Idbxiq roefan (Setlpn ]0.'11.5 Buviwet aM Prolpepns Cotla: Atry c1y a munly MiT �puLes a pe�mE b wmWc1. eda.'v�wa. ^�oleh. a repei ury niuqure. pnor b as e�uenca, ebo repu'va tM appGmV br aN pemd io Na e egned ammsu Nm M p�he ynaE punuenl to the pwieiw W tlr Canlrmaare liren�a lew �Cheqm 9(mmnarv'aq wnA Sequn )OW) d 0'viian J d ihe Nn vM Prdexbm Cadel n thm M a ehe ia uemq �herelvn erd Ne baao la tln aOepeE memqion. AM'volmion d 6eaion ..,.� s by eny appGuni t« e pmmn suejem iha epplum �o a aal penely d nd mora �han fne hundied dd4n �55Wp. � I.movmerdthaperoMamvanWw�wYhweYe+miM1eisdemmv�+Vion.WldoUsxak.end�hotl'uCuiebnolirtlwked a M«d ror eele (senion )ou. Buvrou ene PMaafne Code: TheCw'euan lioaroelewdoes ia wV�i�o en o.nerd popeny M�10 �III}y! C! TP��S I�INlCII. Vld N1q QOM tlM�l MIXk �%T8ld Of hBAO� IX I�MWjh hO IX �1Y OWII tl11pO�M�. p10IM�ld ��W tllL�l impmvaneMs me not inlaMed a dlad fa eab. tl, howewr, ihe buikvp a'rnqv+emM is �dtl wilhin aa yw M mmqMion, �M owmr-builder will heva tha buken d qovi�q M a sM dN mi buiW w imqan In �M puryws d eeb�. ❑ I. m ox�wr d iM MW�Y, em vduwMy mnlrad'nV xiln IimneeA cantrecws lo canmud ihe pN� (Seaun lOs�. Bwi�s. vd Pmleaeione Goda: Tha Coniream liconn law doee na wMY m en owrw d pw�Y xho buitla w imV�+m tMreon vM Ma convecta br wiW MQeas wnh e oomreuMe) I'cemeA Wrsuem to �M Canlretlae Lioeme Lewl. � I em eRmmq under $ection: B. B�P.C., lor �hie reawn: Dme: Ormer: i ao naeW unar mm i em ...,e d w uwe�.w,a m. nv��w, a ceumd. wmn w seien wm swo�. xws. usro. .�e 25.SJ�. ard Mtl I n anV Mvre bWCvV omF+�� will / wA M(mcb ane) nsed m mplY wih erid qe�s wdes end �M mPmemWe fa e P�� Iarmnlv.Yan «modifimlion hamtMAi�uTl�anepemem Outiip. RaidWwl omp�utlion eOP�'vuenerzemN IromNue 01W19MM. Dete: ApqFaK: WOPKEN'S COMPFNS�TION DKL�H�TION: I herWy NNm wEs pxuly d pxjuy ane d tla IoOow'vq EaWm'vn: � 1 hew ud wil meinien e canJicue d ooneenl to eaMinwre br xorkan' compenW bn, m pmiEed lar Ey Seuion 3)00 d IM lebar coaa. i« me ron«�,� a m. �x i« w�n ma o� re�..�.d. ❑ i ne.s m,e w me�m� .�onw.• oomv�� ,�enm. m ra��e W sea�m e�oo a me �m« coa. r« n» ro�am� a m. work la whidi thia perm� u"vaued. My wnkeis ownparumion mwrarice mrier enE pdiq numEx ere: c�a: adrv N�mne.: n.ee mr w m,ndmee r u» v�x is ro. a» nurM�ee earas /s�ml a.�++.1 I calfy tM in the pplamerca d IM wak tar xfiich thie pamiG u neuaE. I tlrA iw enplv� uy pvem n uy mervw e n �o becans +uM� to iM v.aikere• mmper.vlion lew� a CeNomie. and +Ores pxt � I Mouk becone nd'ptl to iM wvM1en• oonp,e`�nNion pwiabro d Swion �]OO W tM lebor Cada. I MM /aNwnh mmCM �h tMea pmwio�e. Dtls: "'�, Zl�' al R Mq��c `�' �...t� Wunlnp: FeOun ro wcun woikw�• mnp�n�etlon corwp� h wY�wM uM Ntll a,b/'el an w�rplryw ro almlial pwNu �iM c/vq Ilnu �q b am huWiM tlwuaW OeIMn (tIPqOWJ, N bdltlon m tM cwl o/ cvnpru�tlwt tl�m�pr u prevlMA br In 9ectlon �ll16 0l tl�s leborCods, Inten�f, �M elromry'� I�u. CONSTNUCTION LENDINO IIGENCY: I hereby tlfirm uMer paneXy d perjury Iha tAen u e aonetiudion bnd"uq �wy M IM parlameze M IM work M whirA Ihe M�i u ewetl (Sedion �09). Civ. CI. LENDEH'S NMIE: LFNDEF'S RDDNE59: I cenily ihet I heve reaE I�ie applicelim erd Yma thet the ebave inlormelion e cortw. I yne io camply wit� ell ary enE ooun7 �inenne ud stele kvn nlet�q to buJdvp canaruqion anE hmepyainhorce reqaventmives dlhia dryb anter upon tM e�ws-meMioned poperly �a�°'p�w�°� PHIL HARP I 1nJ � '^` PP1m Name/� ��M1�"' [ V kvlY Dms: `" Z C / sqnmure a oww�Apew ree« (5151eB WP) Whna-Buildiq 8 Sdary; araerFb; Cenery-Appicenl; PinM-Rmeme; OdEen�pLMaevor CITY OF COSTA MESA - bUILDING PERMIT PERMIT NO: B 087701 PLAN CHECK NO: 01491-98 S CONSTAUCTION TYPE: V-N PERMIT TYPE: STR JOH DESCRIPTION : 3095F OF LATTICE TYPE PATIO STRUCTURE CLAIM VALUE:. 2,000.00 CALC-VALDE: 4,900.98 i . '� %� / � �o_ .i,i_: �� /I _ � • �ilaSb�olis � � SQ FT: 309 GROUP OCC: R-3 /U-1 COMMENTS: NEW 309 SF LATTICE TYPE PATIO COVER ��+�x**+r*��*�*�*��*****��**��r*******�+�***�r�****+�*+�**�***��+�**xx**��****��r� Z O N I N G R E Q U I R E M E N T S S E T B A C K S ------------ MAIN BUILDING ---------- --------- ACCESSORY BUZLDING --------- FRNT: FT IN REAR: 10 FT IN FRNT: FT IN REAR: FT IN LEFT: $ FT 6 IN RGHT: 6 FT 6 IN LEF� FT IN RGHT: FT IN �/oi(0— PARKING REQ• PROV: PARCEL: �� ZNE: R2-M REF NO: PLANNING NOTES> OPEN LATTZCE PATIO COVER TO B£ CONSTRUCTED BEHIND A I$L7. 215 �� > CONSIDERED FT OF LOT; ^_^` _ ., n ` • . �� *� �� a��r***�* ��*�r*x * �**�-�*�* x *��*** ��r ��* ��r�e�r x��*��*� �r�� x*�*+r�r*�x��r*� � �*+� D E V E L O P M E N T S E R V I C E S R E Q U I R E M E N T S ZONING APPROVED BY . BUILDING APPROVED BY : LEGALIZATION:N BLDG PMT PERMIT 99.75 PLAN 64.84 ISSUE FEE F E� S U M M AUR Y PLUMBING ELECTRIC MECHANIC DATE; DATE: STRUCTURAL SEGMENT:Y FIRE SMIP/R55� GRADING SMIP/NON-RES bUILDING-DIV-> PERMIT ISSUE PLAN-CHECK TOTAL PAIU DUE TOTALS----> 100.25 0.00 69.84 165.09 165.09 .00 REVENUE DIVISION TOTALS--> COLLECTED: 165.09 OVER/SHORT: .00 BLDG PMT PLUMHING ELECTRIC MECHANIC FIRE SMIP/TOT GRADING PLAN-CHECK 99.75 .50 64.84 'lf 1F IE �(' �E iE'lE iE �E iF'If fF fF iE iE'1E �f' iE iE �f iE �E'1E iE if 1E'1E 1E iE iE iF 3E ik �E if -1f iE iE iE jE �(' #� 1E iP iE if !F if ii' iE iE iF iE-1F �1F-lE if 1k iE iE �If if'lE �E?F iE iE if iE iE 1E iF if if iE if 1E iE if I N D Z V Z D U A L F E E B R E A K D O W N TYPE QTY D E 5 C R I P T I O N UNIT COST TOTAL COST SFR 304 RES-PATIO COVER-FOST 6 TRELLIS 16.12 4,900.48 END OF FEES C4-2J-139&/12:27 P�i/8165.�3 RCP1�:51-oCezb�a PtRT'fIT e 087 /tii . --. ` � CONSTRUCTION AND PLANNING P�� Pa pPPROVALS Permit� Date Inspector APPflOVALS P�t# Date/ Inspector t. Temporory Electrical Service or Pole 52. Pool & Equipment Location 2, Soil'Pipe�Undrgrnd. , 53. Steel Reinforcement • 3. Electrical Conduit Citility-Undrgrnd. 54. Forms 4. Electrical Conduit�Undrgrnd. 55. Electrical Bonding 5. Steel Reinforcement 56. Rough Plumbing & Pressure Test ' - 6. Electrical UPER Grnd. 57. APPROVAL TO COVER�GUNITE 7, Footings K Z,( �Gl�- 58. Electrical Conduit-Undrgrnd. $. Foundation 59. Gas Pipe, O Undrgrnd., Test . � 9. Water Pipe�Undrgrnd. 60. Backwash Li�es, P•Trap, O Undrgrnd. � 10. StructureY FYoor SVstem 61. APPROVAL TO DECK ' 11. Property Sewer Line & House Connection 62. Backwash & Receptor•Final � 12. Sewer Cap • 63. Heater & Ve�t-Final , 13. Roof Drains . 64. Plumbing SYstem � Finai 14. fiough Plumbing � 65. Electrical�Final 15. Rough Elec2rical-Conduit 66. Solar SYstem-Final � 16. Rough Electric Wiring 67. Fencing & Access ApProval � . 17, Rough Wiring Sign 68. APPROVED FOR PLASTERING 18. Aough Elr,ctricahT 8ar Ceiling 69. POOUSPA SYSTEMS F1NAL 1 79. Rough Heating & Air Conditioning FIRE DEPT. REQUIREMENT 20. Rough Factory Firepiace APPROVALS Permit # 21, Ducts, in Structure 70. Underground Hydro 22. Ducts, Ventilating 77. Product Piping �Gas OOiI 23. Gas Pipe-Rough & Test 72. Unde�ground Flush 24. Roof Framing 73. Undergrnd. Storage Tank O Gas ❑ Oil 25. Roof Sheathing 74. Overhead Hydro . 26. T-Bar Ceiling (Structural) & Monoeoat 75. Dry Chemical Z7, Freme and Flashing � 76. Dry Standpipe � 28. Lathing & Siding 77. FIXED SYSTEM FINAL 29. Insulation 78. FIRE PREV. FINAL 30. Drywall Nailing � . HEALTH DEPT. REQUIREMENT 31. Piaster Brown Coat 79. FINAL INSPECTION 32. Electrical Power Meter-Finai � 80. FOOD CERTIFICATE ISSUEQ 33. Final Electric Notes: � 34. Final Heating & Air Conditioning 35. Flnal Gas Pipe�Test 36. Hood or Canopy � . _ � 37. Final Factory Fireplace 38. Final Plumbi�9 . 39. Water Service�Final � 40. Gas Service�Final 41. Solar pomestic�Final 42. Backflow Preventer 43. Backflow Irrigation 44. Landscape Irrigation System 45. Sound Attenaation 46. Handicap (iegulations 47. FINAL STRUCTURE & BUILDING _ 7 4� �� L' 48. FINAL PLANNING � 49, Etectric Release to Edison 50. Gas Release to Southern California Gas Co ' 51. CERTIFICATE OF OCCUPANCY No. Date