Loading...
HomeMy WebLinkAbout1781 ANAHEIM AVE - Building Permits •i �fS • . ' city of Costa Mesa 1( . Building safety Department , CERTIFICATE� 'OF OCCUPANCY a tr? P.O. Box 1200 11 . ,� 2810 .Costa Mesa,California '' m Ave :train_ /J'Jf 1 The Building located at 1989 A lrfhhniAvnun_ lTnitn A-' "A. Pa C (r has been inspected and found to comply with the provisions of all City:of Costa Mesa Ordinances applicable theret v fora Group %e ti T Occupancy. . ,1 Use of Building *M.1 al C3 IAA.ii n+4rnnAor" nurn on Legal Description A v th 14_1 R7.1 o .. • r • (See reverse side for Metes and Bounds) • IcS Building Permit No nnaQ0 Electrical Permit No. R2 'Cr Plumbing Permit No. rf.)1::2 Number of-apartments ~<' - and/or guest rooms A ^� ISSUED TO: � Building Official ' • , - 1 nn -Ann Qf nnnnl t 't Date .4' Sr ?l . 1Q72 + . This Certificate of Occupancy SHALL BE posted in a conspicuous•place on the premises and SHALL NOT,BE removed except by the ' -'Building Official of the City of Costa Mesa under Sec. 306 (e) U B C t ' - . I 'Form BU 34 Rev. 11/70 , I { - t+- -. i, cli II II I • . ctsOWNER STANSELL, Gordon DATE 10-27-70 �J� OB ADDRESS 1781 Anaheim Avenue, A-C BUILDING PERMIT NO. 32388 GENERAL CONTRACTOR W. Fred Smith DESCRIPTION of WORK Triplex w/attached garage 0.116-182-1• LOT TRACT FIRE ZONE VALUE $ 6 4 6.00 Ih.,rrECT10NS S;Inature Dte GROUP I ; TYPE ZONE :— SOIL rre- 11117�►ra SUBCONTRACTOR PERMITS ISSUED CGAS �a Date Number Si•nature WATER .r� r�p , RI mbin•e ROUGH PLUMBING , 7L� 6M1171 9:7ir� ill`220,R� -oi PROP. SWR. LINE (2 HOUSE CON. MI ra.at &i'#f rii77ZInr rae cJ!Wfns ria sr SPRINKLING SYSTEM aleallaallill.MMIIIII MISCELLANEOUS -- ROUGH MPORAR ANDAIR CONDITIONING r✓� TEMPORARY SERVICE OR POLE UNDERGROUND 0 POWER 0 -- ROUGH WIRING lian. ZI Heatn• and Vyst. , TRENCHES fl FORMS ❑ STEEL RE I NF. ❑ FreArdiSafi��/�/� tIgrjil�/`�f'�6 ({j���W�laIarar 1�I FLOOR SYSTEM In Ear/21MMW--/1eI'SAISAL4 n riteeiA2 BOND BEAM • STEEL REINFORCE • r'vliara�i— MEMO SHEATHING r%//iLilIVts+lIJ FRAME AND FLASHIN fG ff ,WIIISISIM-- LATHING - IN Li OUT `illea__ �/�JAMO PI 'TER, BROWN COAT vll ___eSSI S TURAL, FINAL ra � ri � HEATING. VENT., REFRIG. AND A.C., FINAL rr � �� �//%� ttaIIiDlI PLUMBING, FINAL AND GAS TEST • `ZMara �r �� ELECTRIC, FINAL ami niur. FINAl - er / '7 a/ A2OREss«BMLm+c: 1781 ANAHEIM 'AV upT: CITY OF COSTA MESA — BUILDING PERMIT. ONfERSNANE IF KNOWN SZELIGA, CLARA H PERM NO; B 082979 ADDRtSS: 1781 ANAHEIM AVE #3 • COSTA MESA,CA 92627 PERMIT NO: B 082979 PLAN CHECK NO; N GOVT: N SUPP : N APFL.WADE ADDRESS CONSTRUCTION TYPE: V—N PERMIT TYPE: STR PURPOSE: OTH ARCHITECT OR ENmIER: uc.Ng_ JOB DESCRIPTION : T/OFF RESHEATH W/ 1 /2" PLY COVER W/CLASS SQ FT: 5, 818 ARCH OR Eraa's ADDRESS: UMT: CLAIM VALUE: 5, 818 . 00 CALC—VALUE: 5, 818 . 00 GROUP OCC: R-1 /U-1 CONTRACTCIrsNAIt AERO THERM CONSTRUCTION ( 714 ) 966-8303 compthaffsmhum .. .289 LILAC LN COMMENTS : RESIDENTIAL REROOF/ APARTMENTS ADDRESS: COSTA MESA CA MM.: 393321 *aE*sf****ataE***** - -*rfrf**** -sfrr*a<- -*x-rf* -*HESE****Af* -*rtrfx-sf**xrF****NfrE*****rf -yF*rfrF**at**rf** 92627 tIMT. ZONING REQUIREMENTS LICENSED CONTRACTORS DECLARATION:I hereby affirm under penalty of perjury that I am licensed under provisions of Chapter 9 SETBACKS (commencing with Section 7003)of Division 3 d the Business and Professions Code,and my license is n fun force and effect •CITYLIG.NO.:049015 uc.cuss: C-39 UC.No.: 393321 EXP: 09/97 MAIN BUILDING - ACCESSORY BUILDING FRNT: FT IN REAR: FT IN FRNT: FT IN REAR: FT IN DaS—lU—�jrf cent ado �C� LEFT: FTIN RGHT: FT IN LEFT: FT IN RGHT: FT IN OWNER BUILDER DECLARATION:I hereby affirm under peiWy of perjury that I am exempt from the Contractors License Law for the following reason(Section 7031.5 Buaiwn and Professions Code:Any city a county which requires a permit to construct alter,improve. PARKING REQ: P RO V: PARCEL: 42426323 Z N E: REF NO: emdah,or repel any structure.prior to is issuance,also requires the applicant for such permit to file a signed statement Nat he or she PLANNING NOT E S J ,�"I licensed pursuant m the provisions of the Contractors License Law[Chapter 9(commencing with Section 7000)of Division 3 d the ,usiness and Professions Code]or that he or she is exempt therefrom and the basis for the alleged exemption.My violation of Section > f 7031.5 by any applicant for a Permit auMeds the applicant to a dal penalty of not more than five hundred dollars 155001). ******************************************************************************* ElI.as owner of the property ormyehplykeeswithwagesastlasdecompensationi wdothework,edttubintended D E V ESL O P M E N T SERVICES R E Q U I R E M E N 'T' S or offered for sale(Section 7044,Business and Professions Code:The Contractors License Law does not appy to an ower of popery who buids or improves thereon.end who does such work Noised or hared or through he or her own employees.provided that such is d improvements ere not inted «amredfor sale.I,however,the building or m provememd is ZONING APPROVED BY DATE: of proving ownerbuilder will have the burden he or she did not build or improve for the purpose d vele). ./ ❑ 1.asownerdlheMeneay.amexmnivwlycontractigwihlicensed contraamrsmeonmucteMama(Sed ^Mee,Businessad BUILDING APPROVED BY : DATE: . i Professions Code:The Contractors License Law does not apply to an owner of property who builds or improves thereon and who contracts for such projects with a contra:Ws)licensed Pursuant Io the Contractors License Law). , �_2/-�y ❑ Iamexempt uderSection: B.AP.C..for this reason: APPLICATION ISSUED BY: DATE: / 97 ***************************************************************************** * Date: Owner LEGALIZATION:N F E E SUMMARY STRUCTURAL SEGMENT:Y I do hereby certify that I am aware of and understand the requirements of Cauormia Health and Soley Code Sections 15505.nom,,and 25534.and that I or any knure building occupant will/wit not(Wrote one)need to cowl),with Said stale codes and the requirements for BLDG PMT PLUMBING ELECTRIC MECHANIC FIRE SMIP/RES GRADING apermiforconstnrdion«modification Iran the Aka-any�amagement District.Residential cosinictionapplicationsare exempt from these PERMIT 112 . 25 . 58 provisions. Date: Applicant: PLAN SMIP/NON RES WORKER'S COMPENSATION DECLARATION:I hereby affirm under penalty of perjury one of the following decimations: ISSUE FEE ❑ lhave and will maintain acertificate oconsent tosea'insure for workers'compensaon,asprovdedfor bySecton370odthe Labor BUILDING—DIV—> PERMIT ISSUE PLAN—CHECK TOTAL PAID DUE Code,f«the ped«mameoiNewpkf«w;nmpermit apeae.ud. TOTALS----> 112 . 83 0 , 00 0 . 00 112 , 83 112 . 83 . 00 g3 I have and wit maintain workers'compensation insurance,asrequired by Section 3700 ofCode,forof the Labor the performancethe work(«which this pard eeaund.Myw«Ne�ggp)pgngtigg inygyyge,�rder and MOW number are: EXPIRES REVENUE DIVISION TOTALS--> COLLECTED : 112 , 83 OVER/SHORT: , 00 Denier: 265-9 u000 Policy Number: 2u5-97u0000968 01 /01 /98 BLDG PMT PLUMBING ELECTRIC MECHANIC FIRE SMIP/TOT GRADING PLAN—CHECK (This section need not be completed I the petrel is for one hundred dollars($IDD)or less.) 1.12 . 25 , 58 o I cern that in the performance of the work for which this permit is issued,I shall not employ any person in any manner so as to became subject to the workers'compensation laws of California,and agree that i I should become subject Io the workers' **********************W******************************************************** compensation provisions of Sediro 3700 of the Labor Code.I shad 9forthwith campy/wonthose ose proyisioms. IND IV IDUAL F E E BREAKDOWN Date: 5—2•0 -1'7 Applicant: is,(,..e,e„,1e), 44a i Warning:Failure to secure wnrtere'compensation coverage la unlawful,and shall subject en employer to entrust!penalties and TYPE QTY DESCRIPTION UNIT COST TOTAL COST °lull fines up to one hundred thousand dollars($100,000),In addition to Me cost of compensation,damages as provided for In Section 3706 of the Labor Cods,WNW,and attorneys lint SFR 5818 REROOF BY VALUE RESIDENTIAL NOZONE 1 . 00 5, 818 . 00 CONSTRUCTION LENDING AGENCY: I hereby affirm under penally of perjury that there is a construction lending agency for the END OF FEES performance of the work for which the permit is issued(Section 3097.Civ.C). LENDER'S NAME: LENDER'S ADDRESS: I certify that I have read this application end state that the above information is coned.I agree to comply with all city and county ordinances DETECTOR and state laws relating to building authorizeconstruction and hereby representatives of city Mm to enter upon the above entond property SMOKE for inspection purposes. EDWARD E WATKINS REQUIRED 05-20-1997/03:10 PN/$112.83 Print Nellie sI 4,, y,�! RCPT(:01-0006614 EPwAe0 I Gt�1 1` Date: S -10-47 PERMIT:082979 Signature of Owner/Aoent/Apptca t'Contrador (5151-45.WP) White-Building&Safely;Green-Re;Canary-Applicant;Pink-Revenue;Goldenrod-Assessor CONSTRUCTION AND PLANNING POOL PA I • APPROVALS Permit# Date Inspector -APPROVALS Permit #- Date Inspector 1. Temporary Electrical Service or Pole 52: Pool & Equipment Location 2. Soil.Pipe�Undrgrnd. . 53. Steel Reinforcement 3. Electrical Conduit Utility-Undrgrnd. 54. Forms 4. Electrical Conduit-Undrgrnd. • - 55. Electrical Bonding 5. Steel Reinforcement 56. Rough Plumbing & Pressure Test 6. Electrical UFER Grnd. 57. APPROVAL TO COVER-GUNITE 7. Footings 58. Electrical Conduit-Undrgrnd. 8. Foundation 59. Gas Pipe, 0 Undrgrnd., Test 9. Water Pipe-Undrgrnd. 60. Backwash Lines, P-Trap, 0 Undrgrnd. 10. Structural Floor System - 61. APPROVAL TO DECK 11. Property Sewer Line & House Connection 62. Backwash & Receptor-Final • 12. Sewer Cap 63. Heater& Vent-Final 13. Roof Drains - • 64, Plumbing System - Final - 14. Rough Plumbing 65. Electrical-Final 15. Rough Electrical-Conduit • • 66. Solar System-Final ' ' 16. Rough Electric Wiring 67. Fencing & Access Approval 17. Rough Wiring Sign 68. APPROVED FOR PLASTERING 18. Rough Electrical-T Bar Ceiling 69. POOL/SPA SYSTEMS FINAL {I 19. Rough Heating& Air Conditioning - - - FIRE DEPT. REQUIREMENT 20. Rough Factory Fireplace APPROVALS Permit # 21. Ducts, in Structure 70. Underground Hydro 22. Ducts, Ventilating ' - 71. Product Piping 0 Gas 0 Oil 23. Gas Pipe-Rough & Test - 72. Underground Flush 24. Roof Framing - - 73. Undergrnd.Storage Tank 0 Gas 0 Oil 25. Roof Sheathing c�-�.3_z7 @c-e 74. Overhead Hydro 26. T-Bar Ceiling (Structural) & Monocoat J / 75. Dry Chemical 27. Frame and Flashing 76. Dry Standpipe 28. Lathing& Siding 77. FIXED SYSTEM FINAL , ; 29. Insulation - 78. FIRE PREY. FINAL • - J 30. Drywall Nailing HEALTH DEPT. REQUIREMENT' 31. Plaster Brown Coat - 79. FINAL INSPECTION 32. Electrical Power Meter-Final • 80. FOOD CERTIFICATE ISSUED 33. Final Electric - Notes: 34. Final Heating& Air Conditioning 35. Final Gas Pipe-Test 36. Hood or Canopy 37. Final Factory Fireplace 38. Final Plumbing - 39. Water Service-Final 40. Gas Service-Final 41. Solar Domestic-Final • 42. Backflow Preventer 43. Backflow Irrigation 44. Landscape Irrigation System - - - - 45. Sound Attenuation - 46. Handicap Regulations 47. FINAL STRUCTURE & BUILDING T,j-)Q_7 6144 / 48. FINAL PLANNING 7 1_U 1 " "'sT 49. Electric Release to Edison 50. Gas Release to Southern California Gas Co 51. CERTIFICATE OF OCCUPANCY No. Date 32388Of'T 27-7QA PAID 0O114?_ ***178.50 Cl:S COSTAMESA BUILDING-SAFETY DEPARTMENT P.O.BOX 1200 COSTA MESA,CALIFORNIA 92626 • APPLICATION FOR BUILDING PERMIT For Applicant to Fill in Completely RECEIVED BY DATE RECEIVED BUILDING /79/ lZ �jj�p/ 9 L23t"n (�'� DATE S'S]UE/DJ ADDRESS ` IY,v�°j r/ �J / /0 ,J,/ `^/fir PERMIT NO. 0- OWNER OIZ QB14) V /n/VS 6// A.P. NO. f ( 1 D�7 -- ( f�/ BUILDING ADDRESS ADDRESS R C,•l Ia MAIL .( J 24--) Z LU LilI ' /• F. TEL. TRACT y( � LOTd. BLOCK CL(.3 CITY ti(lJ /IV Ig�.fr NO. ' QS IL7 Z Q CONSTRUCTION / NEW ADD ALTER REPAIR MOV DEMO' ISH O I-- LENDER - / o- co X. J V BRANCH J _ /J+�MP �l V) - OWNER � JI/C4yn CO J ADDRESS VALUE J m ARCHITECT TEL. USE $ Q OR ENGINEER NO. Z Q �f FIRE (�/er W CC ADDRESS �,4 _.,..-Cr.-; ZONE TYPE I_ / GROUP/t/ 4-W //�•���v ,7� �. \(� t,J/% APPROVED 1// J �/ W Z NTCD RACTOR (�.I-.� l�I �S.fi �N BYATE/DMZ/^ 7e -o J ADDRESS 722 f W' G/ `a`''dec�f W W ZO NO.OF USE OF NEW�r nwa-- 0_ 1 /J TEL.Q") G PLANS BUILDING ZF CITY aeV/ (� ...G, NO. 0T/7/60I � ..�/ V j/ W O STATE CITY YARDS APPROVED YARDS APPROVED N!r LIC. NO. ��7 /�r LIC. NO. MAIN BUILDING ACCESSORY BUILD' G D O SIZE "``11115555 yy i'^ INOOW.OF BLDGS./t/ (FROM C/L//ST��REET) OF LOT X la4rV9 I NON LOT ST� FRONT 7 FT. FT. — USE OF ____���- EXISTING BLDG. /'� R SIDE i 5 FT. FT. I- SIZE OF Z NEW BLDG. 3 21 iQ ' ROOMS STORIES 2.- L.SIDE 5.--FT. FT. Q EXTERIOR WAL ROOF �J (^/ rr���� C.) COVERING U&O COVERING.4/ C EA/P L' REAR r}v FT. FT. USE OF BUILDING AND WORK TO BE PER ORMED _ DISTANCE BET. _ BET.MAIN& L. MAIN BLDGS. ACCESS. BLIX"=`;. /� 'r \ /may/ ant DATE �y T0 /IIL� �] �CJ//21 CURP.#LE�3 7Q APPROVED 3.4 1 V I- APPROVED ��lt///� L pi/'/ddYj� Co Co �Y 14. DATE fOG / ?� I hereby acknowledge that I have read this application and state „OLD FOR SpEC7 411(R� that the above information is correct and agree to comply with �E(V'�`5 all laws regulating building construction, and I shall not employ any person in violation of the workman's compensation laws of v4--(2, the State of California. m CC /� ['yJ b lib.) I hereby certify that I am properly licensed as a contractor under �) "SO. FT. ! 0 V the State of California Business and Professions Code, Division 3, THE AMOUNT SHOWN UN VALUATION IS FOR Chapter 9, and that such licenses are in full force and tett,or I THE PURPOSE OF ESTABLISH' G A PERMIT FEE ONLY: 0 am exempt from the provisions of the State •f Calif• la Business 0 s .- and Professions Code,Division 3,Chapter 9. vi VALUATION PERMIT FEE $/// m N Signature ofD Permittee I t `Y/✓6/-"if S . 'y76 PLAN CHECK $ 1/4.5-7e..5"-e)' 7 E Authorized Agent TOTAL FEE $ ts2, • 33539 - PAID AUG 1 9-7.i rQ01710 v*****5 00 COSTA MESA BUILDING-SAFETY DEPARTMENT •• P.O.BOX 1200 COSTA MESA,CALIFORNIA 92626 • APPLICATION FOR BUILDING PERMIT For Applicant to Fill in Completely - RECEIVED D I-E ECEIV D DATE ISSUED BUILDING / 78/ /f / 4 6r4 7--I9 / -7/ ADDRESS /J �( / ^7/ //d i/mss d/G/ /yC3C! Cr, F"3,j[v"]�j L��I'Qj OWNER 4/rl![3% f�4irl6GC A.P. Q./14—/i02--, / PE�JVVJ� BUILDING MAIL 27-/%Sp 7241-117•/-/ !/a�.!�O�C .Zj�„r ADDRESS ! 7�/a i /.. / ADDRESS /��p 7 2/IF" II Al<47, //s /N Z G p�/ TRACTQ y LOT BLOCK d 0 CITY r/1/7/4/ 9.?6�0 NO' a936 8%i9 ZZ Q CONSTRUCTION ��� l/ /J NEW ADD ALTER REPAIR MOVING nFmoi LSH ON LENDER L V /(Q Cei`/YAe4 d ,a/ J O ,BRANCH A v-eznc-'O� V """' ' " J N �� ,,// //// , / OWNER ADDRESS (/h 2.,CzCez d 4.re r/p//,!K!/� _ MI J VALUE t I: J m ARCHITECT TEL. USE ' DUP)L Q OR ENGINEER NO. 0(.0 FIRE W 2 ADDRESS ZONE TVP RO(U�P �J ` C-W - APPROVED /7 /1 DATE /f /I' ,/ / W Z CONTRACTOR lOr4d /1D:se•( BY /'T♦r m- Z / J cc ADDRESS Some dr O.Ser/l W W ZJ)7 i0. NO.OF /�� USE OF NEW ZF CITY ' jam NO. -- - (�� /— PLANS•�T BUILDING ��,../f° W 0 STATE /' CITY YARDS APPROVED YARDS APPROVED w CC LIC. NO. - LIC.NO. MAIN BUILDING ACCESSORY BUILDING CO (FROM C/L STREET) SIZE �• NO.OF BLOCS. • OF LOT oz2x' �D NOW ON LOT FRONT F • USE OF ,// ./ 11 EXISTING BLDG. #4'or/mem . ..— R.SIDE FT. FT. I— SIZE OF �,n �'/� NO.OF Z NEW BLDG. /y�//x'y{/ ROOMS /7 STORIES 2. L.SIDE . VEXTERIOR WALL I ROOF COVERING ateO' COVERING _e/ /e5. REAR FT. FT. J USE OF BUILDING AND WORK TO BE PERFORMED DISTANCE BET. BET.MAIN& CL. a MAIN BLOCS. ACCESS. BLOCS. Q / / VAR.# DATE O ev ////C. ��sh :sGnf/y C.U.P. /�� APPROVED I— /J��jj7 � / APPROVED/// �r `/�/� �/ CO Z / e J3Y APPROVED/fro/fa/2r ATE a 0 . �O UI hereby acknowledge that I have read this application and state 7 that the above information is correct and agree to comply with CC all laws regulating building construction, and I shall not employ F-, any person in violation of the workman's compensation laws of CO the State of California. m'9 I hereby certify that I am properly licensed as a contractor under SO. FT. 1 0,- the the State of California Business and Professions Code, Division 3, THE AMOUNT SHOWN UNDER VALUATION IS FOR i Chapter 9, and that such licenses are in full force and effect,or I THE PURPOSE OF ESTABLISHING A PERMIT FEE ONLY: O LC am exempt from the provisions of the State of California Business and Professions Code, Division Chapter 9. VALUATION .(��-C� m PERMIT FEE $ V Signature of t7 m n Permittee l / ,. $ -D. W PLAN CHECK $. al `o • e LI. Authorized Agent TOTAL FEE $ V 33540 COSTA MESA BUILDING-SAFETV DEPARTMENT 'd1G19-71� ;.f001746 � •�*=10 �C P.O.BOX 1200 COSTA MESA,CALIFORNIA 92626 APPLICATION FOR BUILDING PERMIT For Applicant to Fill in Completely /' / /,� ADDRESS /71/ ( lip /le'n 4e c 6f4M-49 RECEIVED BY DAJ —RECEIVED' DATE IS$UED BUILDING // JJ� � //SW ` ��Aj� SIP/ /�', (G 71 OWNER //}7!•�T /i(.L• A.P.NO.///147-1/41—,��i" ��//J�s��PEI�N�IT N MAIL scalp T/�rrr.t ri I BUILDING /'�0 /�.���Aeia'e'•.w'• �/�Q z . ADDRESS /t$DO 77ljf'H !4L%/G GIa9/ ADDRESS lil Ur TEL. -O CITV fT24/ NO. p��//9 TRACT LOT s;� BLOCK ZZ Q CONSTRUCTION }- 1 NEW ADD AL AIR MOVING DFMOI LSH O-N LENDER /S! �!/y a m /�J/ / a) _ d J J BRANCH 'I'4Jeen(tie/ �y G,'n=L�O``—"' J N OWNER S' m J ADDRESS Gy nay O aftetwet ��re� 4101,6“-e-2 VALUE (>, -CO ARCHITECT / TEL. USE $ /are J - Q OR ENGINEER NO U N Q FIRE W 2 ADDRESS ZONE TYPE GROUP 0_W / /� APPROVED �.:/(I (� W 2 CONTRACTOR 744 i,vrlrj�G BY / /t / DATE " / 7/ -Jo m Z / W W ADDRESS ‘87. 6101,G, Z ENOTE . .OF USE OF NEW ZF CITY e7 57#4.4.1 NOL. �� PLANS a BUILDING, ��VLLJ// W 0 STATE CITY YARDS APPROVED YARDS APPROVED fn CC LIC.NO. LIC.NO. MAIN BUILDING ACCESSORY INy 70 SIZE INO.OF BLDGS. (FROM C/L STREET) OF LOT ‘./11/8/OZ • NOW ON LOT FRONT FT. joy FT /.,.t/ USE OF EXISTING BLDG. .89/3Vfqr on f$ R SIDF FT. FT, I— SIZE OF ,t ,^ NO.OF Q Z NEW BLDG. /,;(1,4 40 ROOMS /7 STORIES 2• L.SIDE FT. FT. Q EXTERIOR WALL ROOF �'/ V COVERING //I«O COVERING _l!(.Q(�`S • REAR FT. FT. J USE OF BUILDING AND WORK TO BE PERFORMED DISTANCE BET. BET.MAIN& S Ct. MAIN BLDGS. ACCESS.BLDGS. Q ,/J ..y y VAR.# DATE O (�p/thriy/.s �ets-75, c C.U.P.# /t// /y�s APPROVED � y Y/��//N/T APPROVED�/1 j2 DATE ❑ 49--7/ C e _a N// Z 0 C~.1I booby acknowledge that I have read this application and state D that the above information is correct and agree to comply with CC all laws regulating building construction, and I shall not employ F any person in violation of the workman's compensation laws of y the State of California. m ZI hereby certify that I am properly licensed as a contractor under SQ.FT. 0 the State of California Business and Professions Code, Division 3, THE AMOUNT SHOWN UNDER VALUATION IS FOR Chapter 9, and that such licenses are in full force and effect,or I THE PURPOSE OF ESTABLISHING A PERMIT FEE ONLY: e am exempt from the provisions of the State of California Business 2 and Professions Code, Division 3,Chapter 9. VALUATION pt PERMIT FEE $ /Q'a-d N / 7 Signature of / co Permittee �-6'/ $ // , �� 'gi I PLAN CHECK $ E 0 LL Authorized Agent TOTAL FEE $ /40."--)/40."--)